Conserved Protein Domain Family
TMEM119

?
pfam15724: TMEM119 
TMEM119 family
This family of proteins is found in eukaryotes. Proteins in this family are typically between 217 and 283 amino acids in length.
Statistics
?
PSSM-Id: 318024
View PSSM: pfam15724
Aligned: 13 rows
Threshold Bit Score: 299.405
Threshold Setting Gi: 149634272
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395518002  30 ISVLVQGAVLEDSGGSGELEGSSASSPSLPPPRTPALSPTSVGPRTTSTAGPSPP----TNFLDGIVDFFREYMLLIAVV 105
gi 803214982  28 HSMSLQAGFLEDTGGSGEAEGSSASSPSLPPPQTPALSPTSVGPEPTPLAGPKPP----TNFLDGIVDFFRQYVMLIAVV 103
gi 149634272  14 plllraahtslledggasgegegsssaslppasTPKLSRTSIQPHPTPLDGPAAPapatTNFLDGIVDFFKEYMLLISVV 93
gi 335301348  25 YSVSLQGTFLEDTGGSGEAEGSSASSPSLPPPRTPALSPTSLGPQPTPLAGPKPP----TNFLDGIVDFFRQYVMLIAVV 100
gi 73995358   25 YSMPLRAASLEDAGGSGDAEGSSASSPSPPPPRTPALSPTSVGAQPTPLAGPKPP----TNFLDGIVDFFRQYVMLIAVV 100
gi 514476325  25 LSVSLPAAFLEDVGGSGDAEGSSASSPSVPPPRTPALSPTSVEPQPTSPKGPSPP----TNFLDGIVDFFHQYVMLIAVV 100
gi 564379810  91 YSVSLPASFLEEVAGSGEAEGSSASSPSLLPPRTPAFSPTPGRTQPTAPVGPVPP----TNLLDGIVDFFRQYVMLIAVV 166
gi 694952055  26 RSVPMKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPTTLGGPSPP----TNFLDGIVDFFRQYVMLIAVV 101
gi 395833849  25 HSVPLQPTFLEEVAGSGEAEGSSASSPSLPPSWTPALSPTSLGPQPTLLAGPSPP----TNFLDGIVDFFRQYVMLIAVV 100
gi 562845247  25 HSVALEATFLEDVVGSGEAEGSSAASSSLPPPQTPAFSPTPGGAQPTPLEGPSRP----TNFLDGIVDFFRQYVLLIAVV 100
gi 558217381  25 HSVPVQVSFLEDMGGSGEADDSSASSPSLPPPRTPALSATSVGPQPTPLAGPKPP----TNFLDGIVDFFREYVMLIAVV 100
gi 586534698  25 HSVPLQAAPLEDMGGSGEAEDSSASSPSLPPPGTPALSPTSVGPQPTLLAGPKPP----TNFLDGIVDFFRQYVMLIAVV 100
gi 965983979  28 HSMSLQAGFLEDTVGSGEAEGSSASSPSLPPPQTPALSPTSVGPEPTPLAGPKPP----TNFLDGIVDFFRQYVMLIAVV 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395518002 106 GSLVFLLLFIICAAVIVQQKHKASAYYPSSFPKKKYVDQSDRTGGPRAFSEVPDRTPDARPDDaAVDASRQLQADILAAT 185
gi 803214982 104 GSLVFLLMFIVCAALITRQKHKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDGRPEE-TLDSSQQLQAHILAAT 182
gi 149634272  94 GSLAFLLLFIVCTALVVRQKHKASAYYPSSFPKKKYVHPSDKAGGGRAFSEVPEKPPAARPQE-PLDASCQLQADILAAT 172
gi 335301348 101 GSLVFLLMFIVCAAVITRQKHKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDGRPEE-ARDSSQQLQADILAAT 179
gi 73995358  101 GSLAFLLMFIVCAALITRQKHKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDGRPEE-ALDSSQQLQADILAAT 179
gi 514476325 101 GSLAFLLMFIVCAALITRQKHKSTAYYPSSFPKKKYVDQSDRAGGPRVFSEVPDRAPDSRPEE-ALDCSQQLQADILAAT 179
gi 564379810 167 GSLTFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPHAFSEVPDRAPDSRQEE-GLDSSQQLQADILAAT 245
gi 694952055 102 GSLAFLLMFIVCAAVITRQKHKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEE-ALDSSRQLQADILAAT 180
gi 395833849 101 GSLAFLLMFIVCAALITRQRHKASAYYPSSFPKKKYVDQSDRAGGPRTFSEVPDRAPDGRPEE-ALDSSQQLQADILAAT 179
gi 562845247 101 GSLAFLLMFIVCAALITRQKHKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRPAADRPDE-ALDSSQQLQADILAAT 179
gi 558217381 101 GSLVLLVMFTVCAAVITRQKHKASAYYPSSFPKKKYVDQRDRAGGPQAFSEVPDRAPDGRPDE-ALDSSQQLQADILAAT 179
gi 586534698 101 GSLVFLLMFIVCAALITRQKHKASAYYPSSFPKKKYVDQNDRAGGPQAFSEVPDKDPDGRPEE-ALDSSQQLQADILAAT 179
gi 965983979 104 GSLVFLLMFIVCAALITRQKHKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDGRPEE-TLDSSQQLQAHILAAT 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395518002 186 QNLKSPTKGPVANGDGVKVEETE-GRKKDE------EGGaeEEAP-GQGGPS---EKPEAasgeaaeP------------ 242
gi 803214982 183 QNLKSPSRAAPSSGDLARALEVR-SEEEEKg-----PQEadLEAQ-GRALPAekpEVPPL-------P------------ 236
gi 149634272 173 QNLRSPARGPSADGDGVLTEERP-PA-APHg-----GDEfsDGAGrGSWKVE---EEEDL-------Ekadgepqresqe 235
gi 335301348 180 QNLKSPARATLGGGDGARMMEGK-SEEEEKg-----AREvdQDAQ-GQEVLA---EEPDV-------P------------ 230
gi 73995358  180 QNLRSPTRAALGGGDGAR-LDGR-SEGDESg-----GREvdQEAR-GRGSPA---EKPAA-------P------------ 229
gi 514476325 180 QNLKSPARAAPGSGEGARPAEGK-VKEGVQg-----SQEvaSEAQ-ASRSPE---EKPEV-------L------------ 230
gi 564379810 246 QNLRSPARALPGSGEGTKQVKGGsEEEEEKeeevfsGQEepREAP-VCGVTE---EKPEV-------P------------ 302
gi 694952055 181 QNLKSPTRAALGGGDGARMVEGRgAEEEEKg-----SQEgdQEVQ-GHGVPV---ETPEA-------Q------------ 232
gi 395833849 180 QNLKSPARATPGSGDGARVVEg--------------SQGvdQEAQeACGVPV---QELEV-------S------------ 223
gi 562845247 180 QNLKSPSRAAQGSGDAAR-VEGA----EEQg-----DTEvdQEAQ-GPGVPA---EKPQE-------------------- 225
gi 558217381 180 QNLRSPTRAAPSGGDGARMMEGK-SEEEQPg-----GQEedRDAP-GCGVPT---EKPGV-------T------------ 230
gi 586534698 180 QNLKSPARVASSSGNGARVTEGK-SEEEEKg-----SQEadREAE-GRGVSV---ERAEV-------A------------ 230
gi 965983979 183 QNLKSPSRAAPSSGDLARALEVR-SEEEEKg-----PQEadLEAQ-GRALPA---EKPEVpp----lP------------ 236
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 395518002 243 S-CPSEAAAEEPPAV--G---TDP-------------GEREGA--------------LPPEAGEATSLPVPEGPCACG 287
gi 803214982 237 E-EPCSVEMDAAAGA--AaatEGQ-------------GEPDMA--------------PSLAQEAGGPAGPPENPCACG 284
gi 149634272 236 E-EEEKVEEEMAPAS--L---LGM-------------GSPEGAegqcpeaapavavaEEVGATAELPLEAPGEACACS 294
gi 335301348 231 SeEPCPAEVA-------G---EGQ-------------GEPEAA--------------PLLAQETGAQASSPESPCACS 271
gi 73995358  230 A-EPCPAGAEGALEAdpG---PGP-------------GEPESA--------------PSLAQEARGPADPPESPCACS 276
gi 514476325 231 E-ESCSAEVEGAPAA--I---KGQ-------------EEPEGC--------------LSSSQEAQGPAGPPENPCACS 275
gi 564379810 303 D-ETASAEAEGVPAA--S---EGQ-------------GEPEGS--------------FSLAQEPQGAAGPSERSCACN 347
gi 694952055 233 E-EPCSGVLEGAVVA--G---EGQ-------------GELEGS--------------LLLAQEAQGPVGPPESPCACS 277
gi 395833849 224 E-EPCSGVAEEAQAA--G---EGQ-------------GVPEGF--------------LSIAHEAQGPEASPKSPCACG 268
gi 562845247 226 --EPCSVVAEVALAA-------CE-------------GEPEGS-----------------VSPAQGQADPPESPCACG 264
gi 558217381 231 E-GPCSGLAEGVLGV--R---EGP-------------GEPEAA--------------PSLAQEAGDPAGPPQSPCACG 275
gi 586534698 231 E-DPCLAVVEGAVGA--G---EGP-------------GEPEAA--------------PSLSQEAEGPAGPPESPCACG 275
gi 965983979 237 E-EPCSVEMDAAAGA--A---AATxgqgepdmapppaPEPGGP-----------------AGPAGGPAGPPENPCACG 291
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap