Conserved Protein Domain Family
DUF4678

?
pfam15727: DUF4678 
Domain of unknown function (DUF4678)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 318 and 395 amino acids in length.
Statistics
?
PSSM-Id: 318025
View PSSM: pfam15727
Aligned: 9 rows
Threshold Bit Score: 445.14
Threshold Setting Gi: 395823671
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74726496    6 YPLGNVDDSRSKDSPAGEPQGQVPLTadvlAVSSSVASTdwqdiDQASFKTA--TPRAISTSGDKDKSA--VVPEHGQKt 81
gi 562887596  22 ASLGDVADGKSPDSSTGGSQSLVPLP----TVSSAAAPA-----GQDSFTTA--PSEVASTSGDKDKEE--VAPDKSQEk 88
gi 558100451   9 AGIPTHSDSRSSDSPAVGSQSQVSLPad-gTAASGAASTerqdvDPASTKSA--ASKATAASGEENQHEdeADAGHSQE- 84
gi 532081600  22 AFLGNEADHNPAGDPTGGSQGQAPLPadvsPESSAAEATelqdvDQA-------TSEAKPTSGDQDKNE--VAPGSSQK- 91
gi 395823671  19 SPEASLSNSNPADSTIGTSQDEVFPPadvlVSESSPVQTsesspVQVLESSPvqASESSPVQASESSPV--QVLESSPV- 95
gi 344292404  22 ASLGTVADTQSTDSTAEGSPNQ---------ASSTSAPAdqqdvSQASAQPV--ASEAKSKSGGVPEE--------SKR- 81
gi 586543392  12 TSISTHGDSRSSESPTLGSQSQASLRadvpVANGTSASAewqdvDQASIKPD--TSEAVSLPGDKDKHE--DAAEFSQE- 86
gi 73994130   12 asiptdgNSRSPDGPGAGSQNQVGp-----AANGAIASPeqqdvDQASVDSV--TSKPTSASGDQDSYA--VAEGHSQE- 81
gi 149711609  15 ptpGDVADSGSTDSPTGSSQSQVPLIanvsVASSAAAPAerqdvEQAPIESA--TSEATSASGDKDEHE--AAAGHDQE- 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74726496   82 PRKITPLLPSQNPSPLQVSMSLQNPAWDRQVQDARTSQSLVVFPSHLLGKDKMSQMASVPEREPESAPSAPSAE-LQSTQ 160
gi 562887596  89 PREVTALLLRQDPEALKLSTSLQNPEPDRPAPDTRLTQSLVVFSGDPLGNIKTPQTDSVPHSQPEVAASAPKAQ-VWPTE 167
gi 558100451  85 PKEAMAQLAHPAPDARQTSLSLQNLVWAGPVRDSRKTQSLRISHTGSLVKEETPQTAGVPDREQDLDPSTPRAE-AQFPQ 163
gi 532081600  92 PAEITPLVP-QDPGAQPVLVGSQNLLPVRLAGDKLIPQDGVGLLRDSQAQKGTPPQARDPKKQRIFALPAVEV----PPF 166
gi 395823671  96 QASESSPVQAQDSVDLQVSTSLPDQTWDRVVEDSKATHSMVALPHHSLSKEKTPQVEGISNTEPELAPHASSAEgSVGSE 175
gi 344292404  82 PKEVKFLLLDQAPVALQASTSLQNTSVVKPVQEAKTSNSQLTLLQHILVKEETPQTQDVPSGKLGLTPPTPSAE-TQPTE 160
gi 586543392  87 PK-----LVHLAPGSLQMSVSLQNQVQDRPVQNARMTQSLQIFQHGSLVNEETPQTAGVLDGEQELALSTPSAV-AQSPQ 160
gi 73994130   82 PRE--------ASNTLQMSTSPQDPAWDRQGQDSRMIQGLQTSQRDSLAREETPQSAGIPDREQESAPTTPSAE-VQPSR 152
gi 149711609  90 PKEATALLARPAPEALQISVSPQNAGWGGLVQNLRMTKSSRAFQHDSLGKEKTPQMASIPHREQELSPTTPSAQ-VWAPQ 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74726496  161 hmeaqp-----vesdaDhvtagA-----NGQHGPQAASTTKSAEEKAEHPKAPHPEAEALPSDESPVAMGANVVDSLGDL 230
gi 562887596 168 ----------------D-----F-----QGQLDAQASRVTEVAQEGTEGPEASTPDAAALPPSQSKVVTGEDLVGGWQDL 221
gi 558100451 164 nvpa--------vgttD-----A-----DSQLD------TIEAVEKSEGPEAVNPDTEALSSAESQAVTEGDLIDCSRDL 219
gi 532081600 167 vgaad-------pataG-----A-----GGQLDPRPTGVTQAAEEKTKGP---------------QMVTGDDLVDSSTEH 214
gi 395823671 176 siqsqp-----tvsdtD-----TssrdtQDQPEPQATSTTKDAEKKSGSPKALCFNTKISSSSDEFQTVTEDLV-TSGEW 244
gi 344292404 161 spagqpdldtnavspaTqpaggA-----KDQPDTQAAGNTETTQEQPGDPEASSP-----------------LVDSSDEP 218
gi 586543392 161 nvpa--------vstaD-----A-----DIQLDTLATGTTEAVVEKPERPEALHPDTEALPSAEFQVVPELDVTHYSGDL 222
gi 73994130  153 avdaqp-----vgsgaD-----T-----ARQPRGQDTSATESMEADPERPEPVSLDTEALPGAESQGVTEGDLGERSRDL 217
gi 149711609 169 nveaqp-----avstaD-----A-----FDQLDTGASGVTEAVKEKPDGPKALNADTEALPSAKSHTVTEDDLVARSGDL 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74726496  231 QTWFFPPPPAGSVSP--SPGPHEVALGRRPLDSSLYTASEENSYMRSMTSLLDRGEGSISSLADILVWSETT-MGMaiAT 307
gi 562887596 222 QAPSFPPSSEGSASR--SPGPQEVALGRRPLDPSLYAAGEEHGYMRSMTSLLGGGEGTISSLADILVWSEGT-MGMgtAT 298
gi 558100451 220 QAPPVPPSPGSSATC--LPGAPTVALGRRHLDSSLYIACEENAYMRSMTSLLGAGEGSISSLADILVWSEAT-MSM--AT 294
gi 532081600 215 WVQSFPPSAACNAPPpaLPSPHREAPGRRPLDSDLYMADEDNGYLRSMTSLLGGGEGSIGSLANILVWSEPMgMTM--AM 292
gi 395823671 245 QTPPYYPSPENSVSL--LSSPQEVALERTPLDPNLYMASEENNYMRSMTSLLGGGEGSISSLADILVWSETT-MGMgmAT 321
gi 344292404 219 RAQSFSLSQGCSTPA--SPALHPVALGRRPLDSNLYMANEENNYMRSMTSLLGGGEGSISSLADILVWSETT-MGM--AT 293
gi 586543392 223 QA---PPSPRGSVPP--LPGPSIAALG-RPLDSSLYMASGEDNYLHSMTSLLAGGEGSIRSLADVLVWSEDT-LGM--AT 293
gi 73994130  218 RRPSVAP--GGSGPP--SPGPQEVALGGRSLDSSLCMANEEDSYMRSMTSLLGGGEGSISSLADVLVWSETT-VGM--AS 290
gi 149711609 234 QPGLLPPSPGGSAPP--SPAPHVVALGRRPLDSSLYTASEENNYMRSMTSLLGGGEGSISSLADILVWSETT-MGM--AT 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74726496  308 GFLDSGHSTVADLLHSSGPSLRSVPSLVGSVSSAFSSGLVSGTSSALRTITRVLETVEQRTVEGIRSAMRYLTSHLTPRQ 387
gi 562887596 299 GILASGHSSATDLLHGPGPSLRSVSSILESAGSAFSSGLVSGTGSALRSVTHALETVERRTVEGIRSALRYLRSRLPPRR 378
gi 558100451 295 GLLASRHISVTYLLHSPGLSLRLVSSILGNARLAFSSRLV------LRSVNRMLERMEQRTVEGIRSAICYMTSQLT--- 365
gi 532081600 293 AFLTSSHGSPTELLPNPGSNLHSVSSILGNASSAFSSGLATGTSSALRSVTQVLETVERRTTESIRSAVRFLTSHLVRRR 372
gi 395823671 322 GFLASGRDTVADMLHSPGPSLRSVSSILGSASSAFSSGLASGTGSALRSVTHMLETVERRTVEGIRSAMRYLTSHLTTRR 401
gi 344292404 294 GFLGSGHASVTDLLQGTGPSLRSASSILDSASLAFSSGLVAGTGSALRSVTHMLETVERRTIEGIRSAVRFLTSHLTPPR 373
gi 586543392 294 GLLASSRSSVTDLLRSTGPRLRSASSILRNASLVISSGLAAGTNSAMLFIVRMLERAEQRTIEGIRSAVRYLTSHLTPR- 372
gi 73994130  291 ALLASGHSSVTDLLHSPGPSLRSVSSILGS---TFSSGLMAGTSLALRSVTHLLERVEQRTLEGVRSAVRYLTSHLVPHQ 367
gi 149711609 309 GFLASGRGSVTDLLYSTGPSLRSISSILGNASAAFSSGLVAGTSSALRSITHMLERVEQRTVEGIHSAVRYLTSHLTPHW 388

                 ....*..
gi 74726496  388 AQADPNY 394
gi 562887596 379 PQAGASC 385
gi 558100451 366 -HSGPNA 371
gi 532081600 373 FYASPS- 378
gi 395823671 402 AHAGSNC 408
gi 344292404 374 APAGPSC 380
gi 586543392     -------
gi 73994130  368 AHASPNS 374
gi 149711609 389 AQAGPNC 395
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap