Conserved Protein Domain Family
DUF4679

?
pfam15728: DUF4679 
Domain of unknown function (DUF4679)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 213 and 412 amino acids in length.
Statistics
?
PSSM-Id: 318026
View PSSM: pfam15728
Aligned: 13 rows
Threshold Bit Score: 430.806
Threshold Setting Gi: 562868324
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940312   1 MLPVNKDQVLLQNTVPPGCPPQVLS--QFVNSPAPNLASLCPHPTLPSSHF----------PLPA-PPQAYffssltqth 67
gi 410955716   1 MLPQNKDEVLPQNTAPPGRPPQGSS--QLVDLSSGNLQPLPPQPSLPPSHP----------PCSP-PPRSH--------- 58
gi 511891526   1 MEPQNNDQVLLQNAEDPGRPPLGPS--QLEDSPSSHPQPLPPQRSPPLSYS----------PCSPgTPQSH--------- 59
gi 558174708   1 MLPQNKDQGLLQKAAPPGRPPQGPS--QLVDSLPQNLQPLPPQKSLPLAPP----------PCSP-PPQSH--------- 58
gi 586550871   1 MLPQNKNQVLLQNSVPPGRPPQGPS--QLVDSHPPNLQPLPPQKSLTPSHQ----------PCSL-PSQSH--------- 58
gi 311252942   1 MLPQNKDQVLLQKAASPGHPPQRPS--QLVDSLPCNLQPQPPQRSLRPGHP----------PCSP-PLRSH--------- 58
gi 982939475   1 MLPPNKAQVLLRNTASPGRPPQGPS--QTEDSLFYNLQPQPRQQSLRSTQP----------SCSP-PPRSH--------- 58
gi 194220884   1 MLPPNKDQVLLQNAVPPGQPLQSPS--QLVDSPPPNLQPLHLQQSLPPSHP----------PCSP-PLWSH--------- 58
gi 817320202   1 MLPRNKDQVLPQNSVLPRHPPRGLS--XLVDSSPHNLEPLSPHQSLPSSHPpfsst-qfhpPSSP-SPASP--------- 67
gi 297667991   1 MLPQNKDQVLPQTSVLPGHPTWGFS--QRVDSSPHNLQPLSPHQSLPPSHPpfssivpphrPSSP-PPASP--------- 68
gi 282397098   1 MLPQNKDQVLLQNAVPPGCPPQVLS--QFVGSPPPNLASLASHQTIPSPHL----------PLPT-TTQTYlfssltqtr 67
gi 395828900   1 MLPRNKDQVLLQNEVPSGRPPQGFS--QLVDSTSPNLHPLFPQQPPPLSHS----------PFSS-SAQAHlpfpptplf 67
gi 562868324   1 MLPQNKDQVPLQNAVAPGCSPQGFPklQLVDPPPSNLQPPSLQQSLSSSRPpfsstpqsqhFLSP-PPQSH--------- 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940312  68 SPGPHF---SSDSNSDFVP-PHSSSHPRSSSCFGQNYTyfgeKLPSPHSISPSnYQLCVSPPLTGSSSLSQLQHSS-PHS 142
gi 410955716  59 SPGSHFy--NSDSGSDLVLhPYSSSLPSSPTFFHQNYL----SLSLTRSSSPT-RQLYPSLPPTSSSSPTQLQNDSlPHS 131
gi 511891526  60 SPGSRFy--SSDSNSDFILhPHSSSPPSSPSFFHQNYL----SLSLPPFSPPS-PGLYPSPAHTHSSSPSQPQNTPlPHT 132
gi 558174708  59 SPGSHSs--SSDSNSDFVLqPYSSSLPSSPAFFHQNCP----SLSLPRSSSPS-CQLYPSPPPTQSSNPSQPQNSSrPH- 130
gi 586550871  59 SPGSHFy--SSDSNSDFVLhPCSSFLPSSPTFFHQNYL----SLSLPHSSSPS-HQLYPSPPPTHSSSPSQPQNSSlPYS 131
gi 311252942  59 SAGSHFy--SSDSNSDSVLhPYSCSLPSSPTFFHQNYP----SLSLPCSSSPS--RLYPSPTLTHSSSPSQPPNSl-PGS 129
gi 982939475  59 SAGSHLy--SSDSNSDFVLhPYSSSLSNSPTFFHQNCL----SLSPPCSSSPS-RRLYPSATLTHS-SPSQPQNSSfPHS 130
gi 194220884  59 SPGSHFy--SSDSNSDFALhPYSSSLPRSPAFFHHNYP----SLSLPRSSSPS-PRLYPSPTLIHSSSPSQPQNSClPHS 131
gi 817320202  68 SPG--FqfgSSASNSDLAPhPYSLFLPCSPTLFHQNHL----SLSCPRSSSPLnHWLYPSPPQSLSFSPSQPQNSSlPHS 141
gi 297667991  69 SPGFQFg--SCDSNSDFAPrPYSPSFPSFPTFFHQNYL----SLPHPRASSPSnHWLYPSPLLTPSFSPSQPQNSSlPHS 142
gi 282397098  68 SPGPHLy--SSDSNSDFVPlPYSSSLPRSSSCFRTNYTvfgeKHPSPHSTSPSnYQLCLSPPLTSSSSLSQLQNSS-PHP 144
gi 395828900  68 SPDFQFy--SSDSNSDFAThPCFSSLPSSPTFFHQNFL----SRSLQRAYSPLnPKGQPSPPVTLSSSPSQPQNSSlPYS 141
gi 562868324  71 SPGFHFy--SSDSNSEFVPpPYSSSLPSSPSFFHQTHL----S----PPSSPSnHQLYPSPPLTPFSSPTQPQNSv-PHP 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940312 143 -CQSPSRLQDLQSPKITSPVPSSPSPRIQNNKQTWQWPQSGSIK--SSRGAGVCVPSKVDPAEFKDSGTLTQALVDHVGR 219
gi 410955716 132 hRLSPSNPGYHPSSTVTSPAPSLPSPGVHGKRQTWPWHQYRDTG--SPGVVGGCVASQRDPAEFMDPGALAQALVVHLGH 209
gi 511891526 133 qCQPPSPPGDCPSSTVTSLSPSLPSGGVHSNRQVWPRDQYRDTR--SPGLVGECVASEKDPAEFRDPGALAQALVAHLGH 210
gi 558174708 131 -CQSPLHSEDLPSSTLTSQNLSLPCPGVHPNRQTWHWHQHQDTR--SPGVAEGCVASERDAAEFRNPGALAQALVVQLGY 207
gi 586550871 132 hCQSPFRPEDIPSSTITSPSPSLPSPGVRSNRQTWHWHQYQDTR--SPGVVGGCVASERDPAEFRDPGALAQALVVHLGH 209
gi 311252942 130 hCRSPSQPEDLPSSTLTCWSPSLPSRGVLSNSQTWPSHQYRDTR--SRGVEGGCVASERDPAEFRDPGALAQVLVVHLGH 207
gi 982939475 131 pCQSPFHLEDLPTSTLTSPSPSPPSRGVHSNSQAWHLHQYRNTR--SPGAEGVCVASGKDPAEFKDPGALAQALVLHLGH 208
gi 194220884 132 hCQSPSHPEDLPS-------PSQPSCGVHSNRQTWHWHQYRDTG--SPGVVGGCVASERDPAEFRDPGALAQALVVHLGH 202
gi 817320202 142 qCQSPFHPEDLPNSTITSPSPSVPSHRLHSNGQTWHWHQSRDTGsgSPGVVERCVPSEKDPAQFRDPGALAQALVVHLGH 221
gi 297667991 143 pCQSPSHPEDLHSSTLTSPGPSPPSHRLHSNRQTWRWHQYRDIRsgSPGMVERCVPSEKDPAQFRDPGALAQALVVQLGH 222
gi 282397098 145 -CQSPSHLQDFQSSTITSPSPGVPSRGIQSHKQAWQWPQSKNIR--SSGVARGCVPSKVDPAEFKDPGALAQALVVHVGH 221
gi 395828900 142 pCQSPSHPEDLPSSTLTSPSPSPPSGRVHSNKQTWDWHQYGDTR--SPGVEGVCVASEKDPAEFRDPGALAQALVVHLGH 219
gi 562868324 140 rCPSAARP-DIPSPSLTSPSRSLPSPGVHSDRQSWPWHQYRDTG--SPGVAGGCVASKRDPAEFRDPGALAKALVVHLGH 216
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940312 220 RRIARDLQIQFLQRLWLGTPGHAPVVEYPICLVCLQIRTPSCPTPKYKTVPQLLAFPQLLPCVQGQESGPLRIGIGFGLR 299
gi 410955716 210 RRIAHDLRLLLLQHLWLGTTGQAPVVEYPICLVCLKPRSPTCPISRYKTGPRLLAFPQLLPCAQGQESGPLRLGIGFGLR 289
gi 511891526 211 RRIARDLQLLLLQHMWLGRPGPAPIVEYPICLVCLKPRSPSCPIPRYRTGPRLLAFPQLLPCAQGQESGPLRIGIGFGLR 290
gi 558174708 208 RRIAHDLRLLILQSLWLGRTDQPPVVEYPICLVCLRPRSPSCPTPRYRTGPRLLAFPQLLPCAQDQESRPLRIGIGFALR 287
gi 586550871 210 RRIAHDLRLLLLQRLWLGTTGEPPVVEYPICLVCLRPRSPSCPIPRYKTGPRLLAFPQLLPYAQGQESGPLRIGIGFGLR 289
gi 311252942 208 RRIAHDLRLLLLQRLWLGRTGQAPVVEYPICLVCLRPRSPSCPSPRYRTGPRLLAFPQLLPCAPGQESGPLRIGIGFGLR 287
gi 982939475 209 RRIAHDLQLLLLQRLWLGQTDKAPVVEYPVCLVCLRLRTPSCPIPRYRTGPRLLAFPQLLPCAQGKESGPLRMGIGFGLR 288
gi 194220884 203 RRIAHDLRLLLLQRLWLGRTGQPPVVEYPICLECLRPRGPSCPIPRYGTGPQLLAFPQLLPCAQGQESEPFRMGIGFGLR 282
gi 817320202 222 RRITHDLRLLLLQRLWLGRAGQAPVVEYPVSLVCLQPRTPSCPMPKYKTGPRLPAFPQLQPCVQGQESGPLQIGIGFGLR 301
gi 297667991 223 RRIAHDLRLLLLQHLWLGRTGQAPVVEYPICLVCLRPRSPSCPLPRHRTGPRLLAFPQLLPCVQGQESGPLRIGIGFGLR 302
gi 282397098 222 RRIARDLQLQFLQRLWLGTTGPAPVVEYPICLVCLQPRTPSCPTPKYKTVPRLLAFPQLLPCAQGQEPGPLRIGIGFGLR 301
gi 395828900 220 RRIAHDLRLLLLQRLWLGTTGQAPFVEYPVCLVCLRPRTPSCPAPRYRTGPRLIAFPQLLPCAQGQESGPLRMGIGFGLR 299
gi 562868324 217 RRIAHVLRLLLLQRLWLGRSGQAPVVEYPICLVCLRPRSPSCPIPRYRTGPRLLAFPQLLPCVQGQESGPLRIGIGFGLR 296
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940312 300 LPRGQARALHLLPPKNSTPVGveSQEEALQRQK----------STIQESVQIT--------------GTLFQARSLRSId 355
gi 410955716 290 LPRGQARALHLLPERRPEEVG--PQGKAAQARG----------YQTRASQAPAaqvpvaqaradparGPPSPTRSLRST- 356
gi 511891526 291 LPRGQARALHLLPERRPEAAG--PQGKAAQAHG----------HQTQASLAPAaqapvaqeqagpaqGTASQTASLRSAg 358
gi 558174708 288 LPQGQARTLHLLPERRREEAG--PQGEAMQAPG----------YQTHAFQAPAaqawa-----dsasGKPSLTGSLRSAg 350
gi 586550871 290 LPRGQARALHLLPEKKPEEVG--PQGKAPQARG----------YQTRAPQAPAaaqap----ansalGTPSQTRSLRSAg 353
gi 311252942 288 LPRGQARALHLLPERRPEEVG--SQGEAAQARG----------CQAQASQALAaqara-----dlgpGTPSQPGSLRSVg 350
gi 982939475 289 LPQGQAKALHLLPKRRPEEAG--PQAKAAQASG----------CQAQVAQAPAapaka-----dlgaGTLSQNGSFRSVd 351
gi 194220884 283 LPRGQARALHLLPERRREEVG--PQGEAAQAHGcqtqasqapaARAPEARTPAaqaqa-----dparGVPSQTGSLRSAg 355
gi 817320202 302 LLRHQARALHLLPEKRPKEVG--PQGEATQDCG----------HPSQASQPPAaqawa-----dpapGTSSQTRSFRSAg 364
gi 297667991 303 LPQGQARALHLLPEKRPKEVG--HQGKATQACG----------HQSPASQPPAaqaqa-----dpvqGTPSQTRSFRSAg 365
gi 282397098 302 LPRGQAKALHLLPKKNPEGAG--SQEEVLQSQE----------PATQASVQIT--------------GTLFQAGSLRSVn 355
gi 395828900 300 LPQGQARALHLLPERRQAELR--PQGEDTQAHR----------YQSRMSSAPAapapaqp-radpalGTLSQTGSLRSAg 366
gi 562868324 297 LPRGQARALHLLSERTPEEVG--PQGKASQARG----------CQVQASRASAaqapaaqawagaapGTRTQAGSLRSAg 364
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*...
gi 341940312 356 lq-spKPSQC-SRSLLQEPRQVAASPKAGP-SVSKRSVTLGSILRKSP 400
gi 410955716 357 -----HSMRF-SGPLPQAPKQVTVSLKPRPsSARKSPASSEPILQKSP 398
gi 511891526 359 lq-spNSTCF-SEPQPQAPKQATVCPKPTPsSAPKRPVSPEPILRKSP 404
gi 558174708 351 pp-spNSTRC-SGPLRQALKQAAVSLKPGLlSAP-RPASPEPILQKSP 395
gi 586550871 354 pq-ppNSTRC-SGPPLQAPKQATVSLKPNPsSAPKKPASPEPILRKSP 399
gi 311252942 351 pq-spNSMQF-SGSPTQAPKQATVCLKPRPySAPKRPASPEPIHGRSP 396
gi 982939475 352 rq-slNSTRH-SESLTQAPKQATVHLKPRPsSAPKRPASLGPIPQKSP 397
gi 194220884 356 pq-spNPIPC-SGPSPQAPKQAPISLRPRPsSALKRPASLEPIPQKSS 401
gi 817320202 365 pq-ppNSPSCfSGPLPRAPKQATTSLKPRPgPAPKRPVSLELILQKSQ 411
gi 297667991 366 lq-spNSPQCfPGPPPRAPKQATTSLKPRPcSAPKRPVSLELILQKSS 412
gi 282397098 356 lq-spKPSQC-SRPLLQAPRQASASPKSRP-SVSKRSVPLGSTLRKSP 400
gi 395828900 367 pr-spNSTPC-SRPQPQASKQATAFLKPRPsPAPKRAASPELILQKSL 412
gi 562868324 365 pnrspNSTRG-SRPPHHAQKQATASPKPRPsPVPRRSASPKPTPQKSP 411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap