Conserved Protein Domain Family
DUF4681

?
pfam15732: DUF4681 
Domain of unknown function (DUF4681)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 101 and 127 amino acids in length.
Statistics
?
PSSM-Id: 318029
View PSSM: pfam15732
Aligned: 6 rows
Threshold Bit Score: 167.13
Threshold Setting Gi: 823398644
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125863776   1 MAQHAFQDQEQEEGRNSRQQKRKSFEDTMKPKAVELTITETLWDQVLMAFKDIQNELQEDARTRGMS--SVTPTSSASKI 78
gi 831232217   1 MAQNAYQYQQQKAEMTSTQQRSTSAEETRKSQDRKVNITETLWDQVLTAFKDIQNELQEDARIRGMS--STMPMSSAPRT 78
gi 311256539   1 MAQHALQDQGQRSGRTSRHRIRKSIEDTMRPKEIELTITETLWDHVLMAFKDIQKELQEDARTRGMSncSTTPISSVSRT 80
gi 426372365   1 MAQHPCQDQEQKAEMTSKQQRSTSIEETMRPQERQVTITETLWDQLLTVFKDIQKELQEDARIRGMSncSVTPMTSAPRT 80
gi 823398644   1 MAQHIFQDQEQR---TSRQQNRKSTDDTMKPKEIQLTITEALWDQVLMAFRDIQKELQEDARIRGMSncSTTPRSSTSGT 77
gi 655723914   1 MAQHAYQDQEQKTGMMSNQQKSTSIRETMRPQEKQVTITETLWDQVLTAFKDIQKELQEDARIRGMSscSVTPASTTPRT 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 125863776  79 G-TKTSDAATTPKLGRLLSGTGEQPSGIQAQNLRGQSSDQSACYPQP 124
gi 831232217  79 GsIRPPDWGMTPKLRRSQFSTGDQPSGARAYNLKTQLSGQSAYYPGP 125
gi 311256539  81 GsVKPPDSGMTPKLGRSLPSTGD--PGVQGPNLRRQFSDQSPCYPlk 125
gi 426372365  81 GsIRPPDSLMTPKLRRLQFSSGEQPSGGRVHNLKTQLFSQSAYYPGP 127
gi 823398644  78 G-SVGPpdsgmalnlstgeqpsrvhphnlkr---------------- 107
gi 655723914  81 GsIKPPDCGMTLQLRRSQFNTGEQPSAARAH--RTQLSGQSTCYPGp 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap