Conserved Protein Domain Family
PPP1R26_N

?
pfam15740: PPP1R26_N 
Protein phosphatase 1 regulatory subunit 26 N-terminus
This domain represents the N-terminus of protein phosphatase 1 regulatory subunit 26.
Statistics
?
PSSM-Id: 318037
View PSSM: pfam15740
Aligned: 19 rows
Threshold Bit Score: 750.016
Threshold Setting Gi: 556949797
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310    1 MFLMNAPPVVSLQSKWEAFGPPGSFRFPGCFSESKEDVARASVSAKVQMIISTLQQHDTVpLGMSDErR--EAQRSQKAE 78
gi 395506408    1 MFLMNAPPVIALQSKWESFGQSGSFRFPVCFSESEEDIARASVSAKVQMIINNLQSEEAS-LGMNNE-Y--IMQKNQRGG 76
gi 620986001   16 MFLMNASPVVALQSKWESFGQPGSFRFPACFSESEDDIARASVSAKVQMIINNLQSEETS-LGMNNE-Y--IMQKNQKVD 91
gi 556949797   18 MFLMNAPPVAALQTKWRLLGPSSSSSIPICFSESEEEISGTPLEAKVQFIIEALNSAESS-IDMNNE-SenSMQKNTIGE 95
gi 545804971    1 MFLMNAPPVLALQSKWEAFGQPASCRFPRCFSEPKEGIARAAVSAKVHMVISTLQGNGAA-LGMSGE-H--ARQRSQRAE 76
gi 565305803    1 MFLMNTSPLVALPRKWEPFPQSRNCRYPVCFSESEEDLARTAVNAKVQMIINNLQSEEVA-LGASSK-YgcIVQKKQKAA 78
gi 874461038    1 MFLMNASPLVALQTQWESFGPARNCRYPVCFSESEGNVARTSVSAKVQMIINSLQSQESP-LGMNNE-YgcVMQKKQKGE 78
gi 733913780    1 MFLMNACPLVALQTQWESFGPVRNCRYPVCFSESEGDVTRNSVHAKVQMIINSLQSQESP-LGMNNE-CecIMQKKQKGE 78
gi 525016266    1 MFLMDAPPLVALQTKWESFGPARNCRYPVCFPESDSSVTRTSVSAKVQMIINNLQSQEPA-LGMNNE-CacVMQKKQKGE 78
gi 831234251    1 MFLMNAPPVVALQSKWEAFGPPGSFRFPGCFSESKEGVKRASVSAKVQMILSSLQRDEAA-LGMNHE-R--APPRSQRAE 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310   79 RCRDARLAT-SPsACKEQSPAFAACGLAARQgSPPgEEAAADLGPLGLDSDSDDSVDRDIEQAIQEYLKARNGAAQPPSV 157
gi 395506408   77 KYKGARIAAaNT-IVLKKHSTYAKSELSTEF-DHM-EDDSSDFGPLVLESDSDDSVDREIEQAIQEYLKEKSNTIQSLPS 153
gi 620986001   92 QRGGARPAA-NA-LARKE---YHRCS--ADF-DGPeEEGISEFGPLVLDSDSDDSVDRDIEEAIQEYLKEKSHTIQSSAS 163
gi 556949797   96 KSTDGMLVG-GP-IKIEKSSEYSMSSLLSNS-DGTeEEDCPEFGPLAVNSDSDDSVDRDIEEAIQEYLKNKTEAGHSLAE 172
gi 545804971   77 RGHGARLAA-S--------PAFAACGLA-GL-DPKrEEGASDLGPLVLDSDSDDSVDRDIEQAIQEYLKAKSGAA----- 140
gi 565305803   79 KDRGHKFRR-ND-QLLQEHINYTLRSYPTDS-DGMdMEESREFGPLALNSDSDDSVDRDIEEAIQEYLRNKGQNLPPLPN 155
gi 874461038   79 KGAGNRVTS-SStL-LRKHPKYTERGCPAGS-VDTeVEVNVGFETLLLDSDSDDSVDRGIEEAIQEYLKAKSKSDQSLQR 155
gi 733913780   79 KGTSNRVAS-STtL-LQKHPKYTERGCPADS-DDT--EENVEFGTLLLDSDSDDSVDRGIEEAIQEYLKAKGKSDQSLQR 153
gi 525016266   79 KGTSARVTS-SStL-LRKHPQYTQCGCTEDS-GDSeVEENVEFGTLLLDSDSDDSVDRGIEEAIQEYLKTKSKSAQSLPR 155
gi 831234251   77 RCRDARLAA-SP-AVCKEQPAFAACGRADNF-DPMgEEEAADLGPLVLDSDSDDSVDRDIEEAIQEYLKAKGGATQPVSS 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  158 G-A-----QPGRVSPGNSRCKPEPPNS-STPPALGPPKLAPV--L---GSISGISVAAGEDQGSASPVSVSSEDSFEQSI 225
gi 395506408  154 SsA-----TCFGTTNGNNKIKQDLPQN-NVTTHLPPVKFKSDvvS---EAIICNPKGSHDKARASSPLSVSSDDSFEQSI 224
gi 620986001  164 E-T-----EHSGTTGGESRCKPDLSQK-NATSGLLSVKFKAGvvS---ESFIRNHLEVDDQLRSVSPLSVSSDDSFEQSI 233
gi 556949797  173 N-A-----KCPNESKKGETFKKEPAENcILPIDVSKIKSGKN--T---ESNQYDKQEADELPKCSSPSSVSSDDSFEQSI 241
gi 545804971  141 --------PAPGAADGAGGCKSEPPPS-STPAALCAPSLAAG--S---RGVPSSRRRAGEDRGSASPVSVSSDDSFEQSI 206
gi 565305803  156 S-T-----KSLPSKDEGHPVQQKFPSH-NAACHLFPAGYGPV--NlaqPYVIPDHVEHNVVQWASSPCSVSSDDSFEQSI 226
gi 874461038  156 N-A-----ECSENISRDKRFKRQFSQN-KMSSDLLPVKFKAE--Ml-sEEYLSDQLGLGKRLQPASPQSISSDDSFEQSI 225
gi 733913780  154 N-A-----ECSENIARDKRLKREFSQN-KMSSNLLPVKFKAD--Ml-sEEYFSDQLGIGKRLQPASPQSISSDDSFEQSI 223
gi 525016266  156 N-A-----ERSENvsrdkrfkrdfsqN-KVASNLLPVKFKAE--Ml-sEEYLSDHLGIGKRLQPASPQSISSDDSFEQSI 225
gi 831234251  154 R-AqpggaQPSGAIGGASRCKPEPPHN-SAPATPCSPKL-----------IPGSHVGASKDQGSTSPVSVSSDDSFEQSI 220
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  226 QAEIEQFLHKKRQHENPRCEASVDRNPDP---NENAVRATLKTNKEPPIKtAPRQDLRGTSKEFLFRKPPRLVKVISQPR 302
gi 395506408  225 QAEIEQFLSEKKQQEIHKYGISLDKRTEQ---KEVLVKAVPKSNKESIVK-SNRQDLKQGCKELIFKQYPELGKTNVQPK 300
gi 620986001  234 QAEIEQFLNQKRQREIHKHDDPVNRKPEK---KETPVKSAFKSSKESTGK-PRRQAWKQD-YSLTVGLPAELEKT-VQTK 307
gi 556949797  242 QAEIVNFLNEKRQKEATQTA------------DKNLTYKTNASSEKSEEK-E-----AQGKSRLHIKKGTE--KTNSNPV 301
gi 545804971  207 RAEIEQFLSEKRQHETQKCDLPADRKPDA---SNSLAKAACRSGREPTGK-AQQQDPAGACKEFVFRKPPRSAKASAQPR 282
gi 565305803  227 KAEIEQFLKKKKQQGSKK----IMRRNKPfhqKEELEEKLALSQKGSINR-GNQSSLRQRGKAYFSKRHPELQSISTA-S 300
gi 874461038  226 QAEIVQFLNEKKQQEISKCVIGEDK-------KDSQVRSVLKSNKQPTNK-TNCGAMKQDCNALLLRHHPKLRKTSTQSK 297
gi 733913780  224 QAEIVQFLNEKKQQEISKCVIGQDK-------KDPHVRSVLKSNKQTANK-TDCGAVKRGCNALLLRHHPKLRKTSTQSK 295
gi 525016266  226 QAEIVQFLNEKKQQEISKCVTEEEK-------KDSRVRSVLKCNKEATNR-TNCGAIKQGCNALLLRHHPKLQKSSTRSK 297
gi 831234251  221 RAEIEQFLNEKRQHETQKCDGSMDKKLEP---NENSAKSLLKSCKELTVKgAPRQDLTAACKEFVFRKPPRFTKVNAQPR 297
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  303 SLRAKVLP---------------------EPETMGSARLAVP-------KA-------EAAQSKGG-----VRRSAGAG- 341
gi 395506408  301 CFKSKIRT---------------------ESENFGNIRLAPPklagvchPL-------ETAQNKGV-----EKKHSWAN- 346
gi 620986001  308 DLKSKVSA---------------------EPENLSQADGLPLkpgapcrPK-------ETAPNKNE-----GKSGLWAT- 353
gi 556949797  302 SLGCKVAPakqcalssavettstcvkftdTEKVFEQDIITEEtckyvnnPA-------AVKGPKADhavfcAKKNFQDLf 374
gi 545804971  283 GPRSKVTG---------------------EP-------------------PaiagrpaEAAPSRGG-----GRRGAGPG- 316
gi 565305803  301 CLKSKSSG---------------------EPVACKTERQTGF-------STlavhdssFLEENKKN-----RKRPILCNi 347
gi 874461038  298 CLKAKIQE---------------------EPSDFNQVNRAYL-------EMatasqpwLMQQNK----------ASGAN- 338
gi 733913780  296 CLKSKIQE---------------------MPADFDQVDQAYL-------Eaas--qpwLLQQNE----------ESGTN- 334
gi 525016266  298 CLQSKIQA---------------------EPSDFSQVNQAYL-------EMatasqpwLVEQKE----------GSGAH- 338
gi 831234251  298 SLRSRVTS---------------------GPETVGSTKPAAL-------KPatpcrpaEAMQSKGG-----IKRSVGTT- 343
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  342 RRGRQARSP-ALVCEASDSSSDDGIEEAIQLYQLEKTRKE-----A----AGDTLLRAQPREETAPDFP-AGGTGSGVKS 410
gi 395506408  347 RREQRIKSA-ALVYEISDSSSDDGIEEAIQMYQLEKTRKE-----AsstmDSNLLQKTQPRDNKVSDFA-TSIAVGPSKS 419
gi 620986001  354 RRGQRTKSL-ALGNDPSDSSSDDGIEEAIQLYQLEKTRKA-----AnltvDCGLLQDAQPQPESRVTFP-DSFSVGSPKS 426
gi 556949797  375 TNGSKVNVIdSSSAEQPDSSSDDGIEEAIQLYQLEKKKREgvtpmT----VCSSLLNQQFQAETSCNLL-SGDSKCEAKS 449
gi 545804971  317 RRGRRVRSA-TPVREAADSSSDDGIEEAIQLYQLEK-RKE-----A----AGDPPQRSPPGEEKGPGPP-AHSASLCARS 384
gi 565305803  348 GREERVECT-----DLSDSSSDDGIEEAIQRYQLEKMKKAae-srA----GCVSLQKEGFSPNKTENMP---------SS 408
gi 874461038  339 YWETRGALL-NESVHASDSSSDDGIEEAIQLYQLEKIRKEgg-hpT----GSVLLQREQFDAKGIANIS-ASLTISSTKS 411
gi 733913780  335 YWEPSGTLM-DESMHPSDSSSDDGIEEAIQLYQLEKIRKEag-htT----DCVPLQREQFDTKGIADIS-ASLTISSTKS 407
gi 525016266  339 YWEPREALV-KESMHTSDSSSDDGIEEAIQLYQLEKIRKEaghaan-----cvplqREQFDPKGMADIS-ASLTISSTKS 411
gi 831234251  344 RRGKRVRSA-ALVPEGSDSSSDDGIEAAIQLYQLEKTRKE-----A----IGGPPQRAQCLEDKRPDPPtTDSTSSAPKS 413
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  411 VLPEAPRRA-P-SKKKPVALKASDPGLGALDLDHSSKLLKDAKASAPPANTVTKSECGERMSCRADSSAELICAEAILDI 488
gi 395506408  420 ALLESHKKT-LnSKKKQTATKATELSDSSCDSNKLFKPLKETKVSTPPMNTIAKCEFTVQPSFQAETSAELMCAEAILDI 498
gi 620986001  427 ALPENRNRPlR-SKRKRVTTKVTESGQGSNGPNKLLKPLKETKVSTPLVNRIAKCEFTTQVSCRAESAAELMCAEAILDI 505
gi 556949797  450 TACEKPQKP-L-GKKRKHSTKSNELNSMMVNDSNGFE---NNKGSLMPMNKIAKQEVKLGASCRAETSAELMCAEAILDI 524
gi 545804971  385 AWPEAHGKA-P-SRKKPPALKAADLSPDGPDPDQAAQLPKETTAPAPPGNTTANSGRADRSPCRADTSAELMCAEAILDI 462
gi 565305803  409 ALPEISPKAqR-CKRKYASTKAAATNRPGTPCNHLGK----SRRYSPPENSFAKCAVTFQASCRADTAAELMCAEAILDI 483
gi 874461038  412 ASPE-HKNPiS-NKRKEINSKSTELESTSNEFNKLFKPLKKARHFVAPENKIAACELTLQASCRADTSAELMCAEAILDI 489
gi 733913780  408 ASPEICKSPtS-NKRKEINSKSTELESSSNDFNRLFKPLKKARHFVPPENKIAACELTLQASCRADTSAELMCAEAILDI 486
gi 525016266  412 ASPDIHKNPiS-NKRKEINSKSTGLESTSNDFNKLFKPLKKARHFALPENKIAACELTLQASCRADTSAELMCAEAILDI 490
gi 831234251  414 ALPETHRKT-S-SKKKSVAAKPAEPSPGDLDASHTPKLPKETKT--LAVSTASRSEFVERSSCRADSSAELMCAEAILDI 489
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  489 SKTILPAPMES--SDRPPSASPHSHSP-DVPSHL-DGDSSSVDSDDSIEQEIRSFLALKAQSGSVLARAEGSPQPTQGLL 564
gi 395506408  499 YKTIMPSHVES--NDRSLSTNPLFSSQ-NVPSHP-DSDSSLVDSDDSIEQEIRTFLALKAQSEHLLAKPENLSKSVQGPL 574
gi 620986001  506 SKTIMPSPVES--GDRPPSANPVLGSQ-SVPSCP-VSDDSSVDSDDSIEQEIRTFLALKAQSESLLAKPQNLSQSVQDPL 581
gi 556949797  525 SKTVVPPEIVHnvKEKASPTQTIFHSK-NVPYYT-DSDSSSVDSDDSIEQEIRNFLALKAQTNSQSQKDANGPPKAYDAL 602
gi 545804971  463 SKTIPPAPLEG--GDRALPASPLLSPP-NVPSRS-DGDSSSVDSDDSIEQEIRTFLALKAQSGSLLARADPCPPPAQSPL 538
gi 565305803  484 SKTILPLPTAG--DHKLFPTSPSFSSQnVLPSQY-ESDNNIVDSDDSIEREIRAFLAVKARTKHLIAKS-----TFQVPL 555
gi 874461038  490 SKTIMPSQMGS--DNRSLATDSFFSPQ-LLSSSPcESDNSLVDSDDSIEQEIRAFLALKAQSESLVTKPPSLSRSIQMPL 566
gi 733913780  487 SKTIMPSQMGS--DSKSLAADSFFSPQ-LLSSSHcESDSSLVDSDDSIEQEIRaFLALKAQSESLVAKPPGLSHpIQMPL 563
gi 525016266  491 SKTIMPSQMGS--DNKSLTADSFFSPQ-LLSSSRcESDSSHVDSDDSIEQEIRAFLALKAQSENLGTKPPSLSRSNQMPL 567
gi 831234251  490 SKTILPAPAEG--SDRSLSASPLFYSP-NVPSCS-GGDSSSVDSDDSIEQEIRTFLALKAQSGSSLARAESDPQAGQRPL 565
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  565 LlPAPNSQASDPKVPAAhKTPDLSPSCKRKRRGGSNT-----VRLSTPKKTRD---VTEGTQ---DG---DCSQSGA--- 627
gi 395506408  575 L-PEHSNQGSSPKVPLS-KTLKLSLCCKRKLKGERKV-----VKQLTPKKTKGl--ERECPR---ET---EYGQAKI--- 636
gi 620986001  582 L-PGSNNQTGVDEASLT-NTLKLSLSHKKKLKGEKKT-----AKQLTQKTPKEl--EKERPQ---EA---DCSKGKIllc 646
gi 556949797  603 s-PEQMKKVDPNETSLP-RTLKLSLSRKRRKATEDNTegvckVDPQNIKKESEp-cIPPSPL---FDnnmNCRSANE--- 673
gi 545804971  539 PsPGL-------RAPA--KTPDLALSCKRKRGGSGHA-----VRPCAPKRTREtavVPEGAQ---DA---DRGLGRA--- 595
gi 565305803  556 SlGQSRERTQSSKRTFP-KCLKLPLTHKK-----------------TLKRKREivpQNEDAQlisEV---DYLDKNL--- 611
gi 874461038  567 P-SDQNSLTGTLEPSLP-KTLKLSLSRKRRLKREGRV-----VKQDASKAPEQl--GMGFFQ---PD---TYS--KS--- 626
gi 733913780  564 P-SDQNSLAGTLEPSLP-KTLKLSLNRKKRLKREGGI-----AKQgaskaseq------lgtgfipD---NYS--KV--- 622
gi 525016266  568 P-SDPNSLTGTLEPALP-KTLKLSLSRKRRLKREGRT-----AKQRGSKVPEQl--ETGFFQ---PG---NNS--KI--- 627
gi 831234251  566 SpSGPNSQTGGPRAPLP-KTQDLSLSCKRKYRGGSHT-----ARPSTPKKTREv--VKEGSQ---DI---DHTLGTA--- 628
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  628 ----QPsqdirdpPNQ----------GEAGELP--AREGDAKVQP------------------------VPPKTVGLGDV 667
gi 395506408  637 ----HMlqeekdlSSQ----------DKICKSE--SRKDEVTCQI------------------------LSSNLVGLIDE 676
gi 620986001  647 qenpQW-------SRE----------CRPREAE--SCADASRCQL------------------------LSSELVGLIDK 683
gi 556949797  674 ----IL-------PCPasvdssmhtfCSGNGSA--AKQSKTEQQC------------------------HPDVLMAITSK 716
gi 545804971  596 -----------------------------SETP--AREGETQGQP------------------------VPGRTGVLGPE 620
gi 565305803  612 ----PI-----------------------------SSVTQLKNER------------------------TGKMVIYPKDT 634
gi 874461038  627 ----PLlhegcalNSP----------EELCDARrlDSNETTQQQL------------------------MSSELCGSTDK 668
gi 733913780  623 ----PVlqe-gtlTSS----------EGLCGAPmlSSNEAEQQQL------------------------MSSELSESVGE 663
gi 525016266  628 ----PVlqeecalSSP----------SELQNAQ--SNKDSRQQQLmapklsgsdgsrcvaldsvnpflqVQSS------- 684
gi 831234251  629 ----ESgydgqdlPSQ----------GKADEAP--GREGEARGP---------------------------------SGA 659
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  668 PLS-----E-----GPKG----AAKTEEGQSVG-EKESSEDKSSSLDSDTDLDTAIKDLLRSRRKLKKRSRDPRASCKKK 732
gi 395506408  677 RIAldlrnS-----LSQA----HGKVAQERNVEqERPGSGDKSSSLDSDEDLDTAIKDLLRSKRKLKKRCRDPKPHCKKK 747
gi 620986001  684 HVTldlrhG-----LSQV----CGRAGRGRNVEpERSGTEDKSSSLDSDEDLDTAIKDLLRSKRKLKKKPKDHKTPCKKK 754
gi 556949797  717 DSTphkteS-----VHSVd--dKRELSKGHSKIqENYPTDDKSSSLDSDEDLDTAIKELLRSKKKVRKKSKDPKPQFKKK 789
gi 545804971  621 HVP-----AdtqgaVSPG----PGKVAEARPRD-EKESSEDKSSSLDSDEDLDTAIKDLLRSKRRLRKRCRDPRAGCKKK 690
gi 565305803  635 RAS-----IdsisvPCSHtphdSGSLLESITQDlQKYGADDKSSSFDSDEDLDTAIKDLLSSKRKLKKKSKDQRTHCKKK 709
gi 874461038  669 CVA-----Ldsvnpflqvqsg-arklmkntihtqDRDGSADESSSLDSDEDLDSAIKDLLRSKRKLKKKSKEQKSQCKKR 742
gi 733913780  664 CVA-----LdsgnpFLQVqs-gTRQLVKNTIQTqERDGSDDESSSLDSDEDLDSAIKDLLRSKRKLKKKSKDQKSQCKKR 737
gi 525016266  685 ----------------------TRKPTKNPVQTpEREGSGDESSSLDSDEDLDSAIKDLLQSKRKLKKKSKDQKAQCKKK 742
gi 831234251  660 H-------------VPPG----HCKAVEARGID-EKESSEDKSSSLDSDEDLDTAIKDLLRSKRKLRKRCRDPRAACKKK 721
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514462310  733 VRFSTTETRFMERLGSLPG-HWKDRSPRVLRSCLSKSGRDSRAGQGRQ--------LPGVFSSTAEVMKPa----SLGDE 799
gi 395506408  748 VKLSSTGTQFLDKFNKLQK-HWKDKSPHLLKSCLPGSKRDNRENTVKK--------PLNSCNNRTERGKQ-----GKKHE 813
gi 620986001  755 VRFSGTETLFLDKLDSFQR-DWKDNHPSVLKSCLSRSKKDNMENTVKK--------P----TLNTCKSRSe--------N 813
gi 556949797  790 VQFGEAETKE-------KG-DTQTRT-GILKSCLIKSSKDISSESTANklhdhlkgKGNKKMLDHSKTEIcskssGPFGK 860
gi 545804971  691 VRFSTTETQFLDKVGAFQK-DWRDRSPHLLKSCLSKSRKEGG------------------------RPKPd----GTTAE 741
gi 565305803  710 DPFGDAEMRIFCK----NErDSQSQAPTLLKKCLVDSRGDIREGNVKK--------GPLRKPKSTIEFEPe--------- 768
gi 874461038  743 VRFTETDAQLLDEFSSLQQnEWKCKNPVLLKSCLSKSRKAVKENAIRN--------PPDNVNVRLSNERPe------TIK 808
gi 733913780  738 VRCTETDSQLLDEVGDLQQcEWKCKNPMLLKSCLSKSRKTVKENAVRN--------YPDDINVSLSSERPe------AVK 803
gi 525016266  743 VRFSETETQLLDEFSNLQQnEWKCKNPSLLKSCLPKPRKAVKENAVRN--------TPD--NIKLPNDKPe------TMK 806
gi 831234251  722 VRFSTTETQFLDKLGGFRK-DWKDRSPQVLKSCLSKSKRDSGESPMKR--------SPSIFGSVTERTKLe----GTGDQ 788
                         970       980       990      1000      1010      1020
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 514462310  800 DATPGFPSRR--APEGPLFSREMGTPDMVRSALSTSSLSED-SSVDSDDSIELEIQKFLAEKAKES 862
gi 395506408  814 SLQLAFQLEKkiFSKPILVSSDIEINENRNSAISTISLSDDsSSVDSDDSIEQEIRKFLAEKAKYS 879
gi 620986001  814 NVQFSFQVKKqpEAKPVWVTDGLEASENQHSALSTVSLSDDsSTIDSDDSIEQEIRKFLAEKAKDS 879
gi 556949797  861 QHN-----------KPKTFCT-SSSTKDEGSIQVTNVVTDDsSGVDSDDSIEQEIRKFLAEKARES 914
gi 545804971  742 DGSPALRPRDr-AAGGSLFSSETSAGDPPSPAPSASSLSGDtSSVDSDDSIELEIRKFLAEKAKES 806
gi 565305803  769 -------CKKeyQTKPVSGTKIQQATKARPCLWAVRSLMDDsSSIDSDDSIEEEIQRFLAEKAKAS 827
gi 874461038  809 NLEFDLQLKKgyKPEPISNQNNLRVAKNKKCTFTAVSDTDDsSSVDSDDSIEQEIRKFLAEKAKDS 874
gi 733913780  804 NVEFDLQLKKgcKPEPISNQNNLQIAKKRKCSFTAALGTDDsSSVDSDDSIEQEIRKFLAEKAKDS 869
gi 525016266  807 NLEFNLQLKKgnKPKPVSNQRG---AKNRKCVFPAVSDTSDsSSVDSDDSIEQEIRRFLAEKAKDS 869
gi 831234251  789 DVAPTFRLRRn-ASEGNLFPGEH-----QSPAPSPSVLSDDsSSVDSNDSIELEIRKFLAEKAKES 848
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap