Conserved Protein Domain Family
LRIF1

?
pfam15741: LRIF1 
Ligand-dependent nuclear receptor-interacting factor 1
This family of proteins interacts with the retinoic acid receptor RARalpha and inhibit it's ligand-dependent transcriptional activation.
Statistics
?
PSSM-Id: 318038
View PSSM: pfam15741
Aligned: 9 rows
Threshold Bit Score: 874.553
Threshold Setting Gi: 556950401
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778    28 MYQVVQTIGSDGKNLLQLLPIPKSSGNLIPLVQSSVMSDALKGNTGKPVQVTFQTQISSSSTSASVQLPIFQPASSSNYF 107
gi 821484567    1 MYQVVQTTGLDGKNLLKLLPIPNSPGNLLPLVQSSVTSDTSKGNISNPVHVTIQTQLASTPTTASIQFPVFQATNSGNYF 80
gi 620960129   16 MYQVVQTSGLDGKNLLKLLPISNSPGNPMPLVSSSVTTDSSKANLASPVHVTFQTQLNSLSTGPSIQFPVFQPVTAGKYI 95
gi 556950401   27 LYQVVQITDANGKNILKLIPASKISRSVAPTIPSSSITKGSEVNMLTPVTLQLQT---TAMNSISSEVSDFHHPTK-KLF 102
gi 363743150   27 MYRVVQTTGPDGKNLLKLLPISKSSGNFVPIVQSSAMSNNPKVNVSSPVHLAFKTQLASTAAPSSVKIPVFQSPNSGKII 106
gi 733921548    1 MYRVVQTTGPDGKNLLKLLPISKSSGNSVPIVQSSAMSNNPKVNVSSPVHLAFKTQLASTAASSSVKIPVFQSPNSGKII 80
gi 874493617    1 MYRVVQTTGPDGKNLLKLLPISKSSGNFVPIVQSSAMSNNPKGNISSPVHLTFKTQLANTTAPSSVKIPVFQSPNPGKII 80
gi 1020967735   1 MYRVIQTTGPDGKNLLKLLPISKTSGSFMPLVQPPAMPNNSNANVSSPVHLTFKTQLGNTTAPSSVKIPIFQPPNPGRII 80
gi 188595655   26 MYQVVPTIGTDGKKLLQLLPIPKSSGNLIPVVQSPVMSHGLKGNTEKPVQVTFQTQISSSSTSASVQLPVLQPANTTKYF 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778   108 LTRTVDTSEKGRVTSVGTGNFS-SsVSKVQSHGVKI---DGLTM-QTFAV-PPSTQKDSSFIVVNTQSLPVTVKSPVLPS 181
gi 821484567   81 LSATVDKSENARVASVGKESLA-S-ASTAQSNSMKV---ERLAL-QKIAVsPSTTQGDTTYMLVNAKNLPVTVKSPVLPY 154
gi 620960129   96 LTRTLDPPENVRTTSAESKSLP-SkVAAAANAPTPPgaaDRLSLpQNAIVsPPSTQGDTTYMLVNPKNLPVMVKSPGLPS 174
gi 556950401  103 VTRPVDPKEILGVTHGPTVVTSgSpISLTKNAALTV---ANPSS-QRLLA-SSSNSKDKMYMLISSKHLPGTVKSVALPS 177
gi 363743150  107 LARTLDKQEGFKAGSDKESLTT-EsAADIQSSCVSV---DRQSL-QNAAVtSSSEQSHTAHMSVKTKDNPISVKPPVLPS 181
gi 733921548   81 LARTLDKQGGVRAGSDKESLTT-EsAADIQSSCVSV---DRRSL-QNAAVtSSSEQSHTAHMSGNTKDNPISVKPPVLPS 155
gi 874493617   81 LTRTSDKQESVRAGSETESLTA-KsAANIQSSCVSV---DRLSL-QNIAVtSSSNQSNSAYMFVNTKNLPATMKSPVLPS 155
gi 1020967735  81 LTRTLDKQESARAGSEKESLIP-SeAASAQSSCMAV---DGVSL-QNIAItSSSHQSSMTCMVVNTKPLPVTVKSPVLPS 155
gi 188595655  106 LTGTIDTSGKDRVTSMGTGNFT-PpISNTQNHGVKI---HRLTR-QTFTI-PPSTQNDSSYFIVNTPSLPANVNSSTLPS 179
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778   182 GHHLQIPAHAEVKSVPASSLPPSVQQKILATATTSTSGMVEASQMP-TVIYVSPVNTVKN--VVTKNFQNIYPKP-V--T 255
gi 821484567  155 GHHLQIPANAEVKSLPASSLPPPIQQKILAAAATNTSGTAEASKIP-TVIYVSPVNTVKS--VVPKTFKNICPKP-PnpT 230
gi 620960129  175 GHHLQIPAHAEVKSVPASSLPPAIQQKILAAAAPGPSGSTEAAKTP-TVIYVSPVNTVKT--VVSKCWQAICPKPsP--P 249
gi 556950401  178 GQHIRIPADAQVKSLAASSFSPAIQEKILVTAATNISGTNEANKTPaSVIYVSPVNTVKT--VVTKPLPVISPKP-VvkP 254
gi 363743150  182 GHHLQIPADAEVKSVPASFLPASIQQKILAAAATNVTDGADSKKMP-TVIYVSPVNTVKT--ALPKCLQAVDHKP-A--P 255
gi 733921548  156 GHHLQIPADAEVKSVPASFLPASIQQKILAAAATNVSDGADSKKMP-MVIYVSPVNAVKT--VLPKRLQADDPKP-A--P 229
gi 874493617  156 DHHLQIPADAEVKSVPASFLPPAIQQKILAAAATNVSGGADSTKIP-TVIYVSPVNAVKT--VLPKRLQTICPKA-A--T 229
gi 1020967735 156 GHHLQIPADAEVKSVPASLLPPSIQQKILAAAATNVSGGADSTKTP-MVIYMSPVNTVKTsqVLPKHLQSFCPKP-A--A 231
gi 188595655  180 GPPLTIPAHAEVKPVLASPLPPLVQQKILGTVTTSTSGTVEASQIP-AVFYVSPVNSVKI--IVDKKTQNIYHKP-V--T 253
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778   256 EIAKPVILNTTQIP-K----NVATETQLKGGQHSQAAPVKWIFQDNLQPFtPSLVPVKSSNNVASKILKTFV-DRKNLG- 328
gi 821484567  231 EAAKPMILNTSQTPvK----NPAADVTNNEGQQSRDTPMKWVVKENPQCS-PCLVPVKSSNNMASKILKTLM-DMKNVE- 303
gi 620960129  250 EASKAVILTGPPTPaK----GAAPDVGAKASPPAQGTPMKWVVQRNPQCSsPCLVPVKSSNNVASKILKTLA-DMKNVQ- 323
gi 556950401  255 STSLTRITEAYEME-NrfttGMIASPALPTSNNIAQSPMKWVVQENPQFSaPCLVPVKSSTNAASQILKSLAaDLQHVEq 333
gi 363743150  256 DVSKTLLMTAPQKA-H----SSSPETGMSDGQQCQHTPMKWIVRESPQLPaPCLIPVKSSNNVASKILKTLS-DMKNVE- 328
gi 733921548  230 DVSKTLLMTAPQRA-H----SSSAETGTSDGQQCQHTPMKWIVRESPQLPaPCLIPVKSSNNVASKILKTLS-DTKNVE- 302
gi 874493617  230 DVSKTLIMTATQMA------NCSSETVKSDDQKCQQTPMKWIVQESPQLSsPCLIPVKSSNNVATKILKTLS-DMKNVE- 301
gi 1020967735 232 EVSKTLIVTTAQKG-S----GSSPEPVTSEGQQCQQTPMKWIVQETAPLSaACLIPVKSSNNVASKILKTLS-DTKNVE- 304
gi 188595655  254 -------FSTSQIP-P----NVATKTQLNSGQHPQAAPVNLIFQEYLQPGiPCLVPVKSSNNVPSKVFNTFV-DRKTLG- 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778   329 --DNTINMPPLSTIDPSGTRSKNMPIKDNALVMFNGKVYLLAKKGTDVLPS-----QIDQQ--------NSVSPDTPVRK 393
gi 821484567  304 --TSSLNMPPLCSGTSGGTQAKITPIKDNALVMFNGKVYLLAKKGSEVLPS-----QTDQQ--------NSVASDASPRK 368
gi 620960129  324 --STSAGILPLCSGGSAGSQSKITPIKDNALVMFNGKVYLLAKRGSEVLVP-----QVEPQsppsssssPSSSSDIMSRK 396
gi 556950401  334 plSTNAAMPLLSTNSPESPSVKSAAAKKNALVMCNGKVYFMAKQGPEVGTTspkqnQSKDQ--------ATCSQSNEVQN 405
gi 363743150  329 --VNSANILPLCSSGSGVSQTKITSIKDNALVMYNGKVYLLTRRGSDVLSA-----QADMQ--------ASSSYSASLKK 393
gi 733921548  303 --INSANILSHCSTGSGVSKTKITSIKDNALVMCNGKVYLLTRRGSDVLSA-----QADVQ--------ASSSYGASLKK 367
gi 874493617  302 --VNSANILPLCSSGPGGSQTKITPFKDNALVMYSGKVYLLTKRGSDVLSA-----HVDKQ--------ASSSSDASLKK 366
gi 1020967735 305 --VNPANILPPCSNGPGGNQTKITPLKENALVMYNGKVYLLTKRGSDVLSA-----QAEKQ--------TSSSADGLLKK 369
gi 188595655  320 --DNTVGTPLLSTNSSSRTQSISVPIKDDGLIMFNGKV-LLNKKGTYGLPS-----KIDQQ--------NSVSSDIPL-K 382
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778   394 DTLQTVSSSPVTEISREVVNIVLAK-SK---SSQMETKSLSNTQLASMA--NlrAEKN-KVEKPSPSTTNP-HMNQSsNY 465
gi 821484567  369 DMSQTPNSNSVTKITNEVVNIVLAK-NKt--IPQKETKLISDTQLASEPvpS--LEKNnKVECTSLSAQSPqHVTQP-LC 442
gi 620960129  397 DPPQLADSS-VSKITSEVVNIVLAKrNNslaTPQKDTKEGGEGQLDSES--A--TEKKpRAGSALLSTPRPhKVNTPiGQ 471
gi 556950401  406 LQARTLDSVAISKIS-KAVRAVLSK-NMgskLPQIN---LPRSEKSVQT--T--LKRHvKTE-ACQEFPSTkKENQRvLH 475
gi 363743150  394 GTSKLIDSTEVTKISSKVVNLVLSK-SKgmpLPQKDPKVCSNSKVSSSG--G--LRNDlKSTSAALVTPS---AEEQsST 465
gi 733921548  368 GTSKLIDSTEVTKISNKVVNLVLSK-SKgmpLPQKDPKVCTNSKVSSPG--S--LRNNlKSVPAALVIPS---VEEQsST 439
gi 874493617  367 ETSKLIASTEVTKITNKVVNLVLSK-SKgmvLSQKDSKMGANAKVSPSA--G--LRSDlKSAPAALVTPS---VKQRsST 438
gi 1020967735 370 ETPKQIDSTKVNKITSKVVNLVLSK-SKgvvLSQKDPKPCTVSKNSSPV--A--LRNDlKSTPAAPLVSG---ANQQdPT 441
gi 188595655  383 DSSQVVSSSLVTEISREVLSSVLVK-SK---SFQLKTKSLSNSQPAPMA--HikPEKSeKVERPSFSVTSphtTNQStHC 456
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778   466 LKQSKT--LFTNPIFP-VGFSTGHNAPRKVTAVIyarkgsvlqSIEKiss----svdATTV-----TSQQCVFRDQEPKI 533
gi 821484567  443 LEQCKT--APIKLNLP-DVVSPAQNAKKETSVSH---------TKEK----------SSSDdt-ttTSKHCVYTDQEPKN 499
gi 620960129  472 GEQGKTaaLPREPSLP-RGVGTDANAILERDGGS---------SKEKfss----padPATV-----SSHRCTFTDQKPKI 532
gi 556950401  476 VK-------PQNEELQ-RENGDLSNF----SVSK---------EREEilntipknisLMSSelygrTGDMQQHSDVNPS- 533
gi 363743150  466 VNRGKS--LPFMESIS-SGMTPVTAVGMQETTy---------qDDKEmih----sskAASAvl-pqSEHECAFSEDWQKV 528
gi 733921548  440 VNQGKS--LPFMESIS-SGMTPVMALGMQENAc---------qDGKEmihspkaasaVLpqseh-----erafsEDWQKV 502
gi 874493617  439 VIQGKS--LPLTMSIS-SGATPITAVGTQENVc---------qGGKEmih----sprAASAvl-pqSKQECAFSEDWQKV 501
gi 1020967735 442 VIQRQS--LPFTKSVScSGVIPVPAVGMQENVw---------qNGKDmsh----spkAAGAvl-pqAKQECAVGEDWPKI 505
gi 188595655  457 LKQSKI--VFINPVFS-DGFRTGQNTPRKENL------------IQNirs----svdAATV-----TSQQCVFRDQEPQT 512
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778   534 HNEMASTSDKGAQGRNDKKDSQgrsnkalhlKSDAEFKKIFGLTKDLRVCLTRIPDHLTs---gEGFDSFSSLV---KSG 607
gi 821484567  500 QGEMAFVLETYTHSRSQRESCP---------KEYAELRKNFGITKDLRVRLTRIPLFDS-----TSLYSPTSLT---NNI 562
gi 620960129  533 QGAMAPAPEGEAPAGREPKTCR---------KQEAELRKKFGLVRDLRVRLTRIPVFRDa---eERKSPPGGLE---NHH 597
gi 556950401  534 -SDTMFSSVKETLGRSKEKGLYn--------ESDDQLRKKFGLNADVRVHLNKIPIQSFsv-vsKKHASPSAVT---EME 600
gi 363743150  529 QCKKMYSVGKVNQIRDQEKPHW---------KQYLQLRRKFGLYKEERVYLKRIPLTTScekpdERLCSSNSLE---RKN 596
gi 733921548  503 QRKKMYSLGKVNQIKDQEKPHW---------KQYFQLRTKFGLYKEERVYLKRIPLTTYrekp---derVSSSNsleRKN 570
gi 874493617  502 QHEKMDSQGKINQIKHQEKPHW---------KQYLELRRKFGLTKEERVYLKRIPLITSsekpdER------VC---SSN 563
gi 1020967735 506 PCEKMDSPGKVIQIKHQEHPHW---------RQYLELRKKFGLFKEERVYLMRIPLRAFcenpeERVCSSDSLE---RKN 573
gi 188595655  513 QYEMASILKKDIQERSNKKYSQgnhtkasylKNDAEFKKIFGLTKDLRVCLTRIPDHLSs---tKSFDSFNNLM---KSS 586
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778   608 TYK------------------ETEFMVK---------EGERK----QQNFDKKRKAKTNKKMDHIKKR-----KTENAYN 651
gi 821484567  563 SSK------------------ESKIIVDlts----ekEEESQeltvQQDLDKKRKAKTVMKVDSTKKK-----KSGNDVN 615
gi 620960129  598 SFQ------------------EAKFRVEptg----gkEEPNKketvEQDLDKKRKAK-VQKTTSAKRR-----KPGPDCP 649
gi 556950401  601 DPS------------------GMEFMTKldspmtkniEGNEVkiksEQGSARKRKSADAEIVGQAKKRpntfeNSSNRDS 662
gi 363743150  597 DSCpss-------------slDVTITDQhqe----wiEEEKAilnlEEGLSKKRKTK-SSLPDSGKRR-----RTSVKSA 653
gi 733921548  571 DSCpss-------------slDVTITDQhrkcike----ekvilglEEGLSKKRKTK-SSLPDSGKRR-----RTSVKSA 627
gi 874493617  564 NLKtrndscvsssldvtitnqHQECVTEekii------------vdlEDTSKKRKIKSSSVSDSGKRR-----KTSVKST 626
gi 1020967735 574 DSCsss-------------slDVEIRSHhqg----cvEEKKIivdlEEDLIRKRKINSSPLLDSGKRR-----RTSIKPA 631
gi 188595655  587 SYK------------------DANVVMK---------EEKK------QSFSKKRNAKPMKKMDYTKRR-----KIENASD 628
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74744778   652 AIIN--GEANVTGSQLLSSILPTSDVS-QHNILTSHSKTRQEKRTEMEYYTHEKQEKGTLNS--NAAYEQSHFFNKNYTE 726
gi 821484567  616 SSMD--TGTDHTIPQVLNSTLPNSALLpQSNNLTGCMKSHQENSPELELHAPGGLDRGTRSPasVSFEQDPPDSQDCYID 693
gi 620960129  650 VSPN--PHGNSPRPQRQPSGGARSAESrEAGHPVT-TSPVQETSSEPEACSPNNLPSSTWSPacALFEPDLPICQGAFTE 726
gi 556950401  663 ESPC--STSSGPNSKRFSSKLVKTQERfPANSEADSKVLFLEQKSEESSNSNSAVEKENMNSilGTSAEPEKHHGEICTG 740
gi 363743150  654 TSSS--TEDSSPSSITHnrSVSPPPALsQQSISTDFISST---DAEREPSSQNSDVTDSDIPvlVSCEDHASLFEGSFRN 728
gi 733921548  628 TSSG--TEDSGPSSITLnrSVSPPPALlQQSISTDFISSA---GAEQEPCSQNSDVTDSDIPvlVSSEDHASLFEGSFRD 702
gi 874493617  627 TSSN--SEDAGPSSILLnrSASPPPVLlQQSISTDFVISPVGRDSEQETCSQNSDVIDSHIPvlVSCEDHTSVFEGSFRD 704
gi 1020967735 632 TSPS--LEITSSTSSAL--AISPPAASpQPSVPPGSATGSQGRDSEQDVLPWHSDTAHPGISvlVTSEEDTSVLEGSFRD 707
gi 188595655  629 MVMNvmNGTDVANSQLLssILPISDIA-QHNIITSHSTTREDKRTETEHCCHEKQEKGTLSS--STSFEQSNYFNKNYTE 705
                         810       820       830       840
                  ....*....|....*....|....*....|....*....|..
gi 74744778   727 DIFPVTPPELEETIRDEKIRRLKQVLREKEAALEEMRKKMHQ 768
gi 821484567  694 ESFPTTLPELDETIRDEKIKRLKQLLKEREAALEEIRKKMQQ 735
gi 620960129  727 DTFPSTPPELDETIRDEKIKRLKQLLREREAALEEMRKKMHQ 768
gi 556950401  741 DFFPVEPLDSDITPGDEKIRKLKELLREREAALEEIRKKMFY 782
gi 363743150  729 DTFPLTPPDLDETIRDEKIKRLKQLLREREAALEEMRKKnaa 770
gi 733921548  703 DAFPLTPPDLDETIRDEKIKRLKQLLREREAALEEMRKKnaa 744
gi 874493617  705 DAFPLTPPDLDETIRDEKIKRLKQLLREREAALEEMRRKMQQ 746
gi 1020967735 708 DAFPVAPPDLDETIRDEKIKRLKQLLREREAALEEMRREMQQ 749
gi 188595655  706 DIFPVTPPELEETIRDEKIRRLKQILREKEAALEELRKKMHQ 747
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap