Conserved Protein Domain Family
DUF4686

?
pfam15742: DUF4686 
Domain of unknown function (DUF4686)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.
Statistics
?
PSSM-Id: 318039
View PSSM: pfam15742
Aligned: 22 rows
Threshold Bit Score: 251.529
Threshold Setting Gi: 847168938
Created: 1-Aug-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81897685   170 LTSGEKTSC-QHQGELRELRQNLRRLQILCNSAEKELRYERGRSLDLKQHNSLLQEENIKIKIELKQAQEKLLDNARLHS 248
gi 556971256  810 VKSQESLLR-QQTEEVQQFRQDLHRVQNLFSSAERELRYERDKNLDLKKHIALLQQENTKVNAEIKQILSKFSDQEQTSI 888
gi 973210781  780 aKSQDALLQ-QKGEECRQIRQDAQRTQSLFTSAERELRYEREKNLDLKKHNALLDQEKLRVCAELKQAQARLTQLEQSSA 858
gi 597754830  741 aKAQDSVLQ-QKGEENKQLKQDLQRTQHLFTSAERELRYEREKNLDLKRHNALLDQEKIKLCAELKQAQAKLAQLETCTT 819
gi 528517820  731 VKAQDSLLQ-QKGEENKQLKQDLQRTQHLFTSAERELRYEREKNLDLKRHIALLDQEKVKLCAELKQAQAKVAQHEGNAA 809
gi 765124602  520 IKSQDSVLS-QKAEEAKQMKQDLQRAQSLFTSAERELRYEKEKNMDLKRHNALLDQEKLKISAELKQAQLKLVQVEQKVS 598
gi 542210765  626 ikSQDSVLK-QKTEEAKQMKQDLQRAQSLFTSAEKELRYEKEKNLDLKRHNTLLDQEKLKLSAELKQVQTKLVQMEQKVT 704
gi 847168938  573 LLAGDTLIQ-QQHEEIRQLRQDLHRAQHLCSSAEKELRYERDKNLDIKKQHFCLEQANTMVSAELNQLKQKFANVTATCL 651
gi 971429614  701 qslSEERFQ-QQEERLQQLRHDLRRVQNLCSSAERELRYEREKNIDLQKQNLLLQQECTKVKAELKQARTKLLDSTETCS 779
gi 821475919  237 ssidkrLRYqHQGEEMQKLQQNLQRVQTLCSSAERELQFERTKSFDLKQHNNLLQEENIKIKAELKQAQKKLLDSTKMCS 316
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81897685   249 SLTAEWKHCQQKVKELELEGLRQTQSLKSQQGLQEKLAREKSKAAEAQEKILDLQQKLDHG-RQVCLSDVCILRKKQLEE 327
gi 556971256  889 GHRVELDRSQLKVKELEIEVAKLRQTTKLNKSLQEKLADERSRAIDADKKVLELQQQLNAAqHQLHLLETRVQEKELLEE 968
gi 973210781  859 SLGGELERVQQRARELELEMARGCQSRQAQHSLEEELCSERARLLAADKKVLELQQQLKSAlHQLRLEETRASEADRLHR 938
gi 597754830  820 GQTADLEQLHQRTRELELELARSSQNKQTSNSLREELNAERARVITADKKVLELQQQLKNTlHQLRLEEARAGETSKLER 899
gi 528517820  810 GQVAELERLQQRARDLELEMARSSQNRQTNSSLMDELNSQRSRVIAADKKVVELQQQLKNAlHQLRLEEARSGETSKLER 889
gi 765124602  599 SQTAEIECQQQKIRELELELARTSTNHRASSSLQEDLQAERARLIAADKKVLELQQQLKNVqHQLRVEEARASESSRLER 678
gi 542210765  705 GQAAECEHQQQKIRQLELELARSSTNRSATTSLQGDLQAERARLIAADKKVLELQQQLKSVqHQLRVEEARAGETNRLER 784
gi 847168938  652 KLENELEMKQQRIKEMELEVLKQTQISKVQNNWQEKLEHEKSQAHEAEKKILELQQQLRASqHQLQLVQSQVAERKHLEE 731
gi 971429614  780 SLSAQWEKSQQKVKELEQELLKCSQADKLQSSLQEKLVQEKSKVYEAQKQISKIQQKLKDSqHQLLLAEARVSDKKLLEE 859
gi 821475919  317 SITANWESSQQKVRDLEQEILKQSKNIQSQNSLYEKLAQEKTRVAHAEKMVLELQKKLEVA-SESC-TEACILDKKQLEE 394
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81897685   328 EIKEAKSIEARLQQQCQEEQQRRILLDQDINELQTQVRALQDKEEQQEAVNSq------qQ-----------EALRKQLE 390
gi 556971256  969 EVREGKENVARLRGRLQEEQLQRKLLDQNVEDLQQQIKSLRGREASISQTNTelqlrlqqR-----------ETQLQVLE 1037
gi 973210781  939 ESKDMAQTLGALRAKLQEEQLQRKRLEQREEELQQQARSLREREASLTRATSelglrlqqQ-----------EARLGVQQ 1007
gi 597754830  900 DTRDMSDNLSALRAKLQEEQLQRKLLEQREEELQQQVRSLRMKEATLSRTNSelthrsqqM-----------DTRLEVLE 968
gi 528517820  890 DTRDMSDNLSALRAHLQEEQLQRKLLEQKDEELQQHVRSLRAKEASLVRTNLeishrvqeL-----------ETRLQVME 958
gi 765124602  679 DSRDLSDNLSALRAQQQEQHIARKLLEQREEELQQQVRSLRLKEASLSRTNTelshrvqqL-----------DIRLSISE 747
gi 542210765  785 ESRDLSDALSSLRAQQQEEHITRKLLEQREEELQQQVRSLRHKEASLTRTNAelshrvqqL-----------DTRLSVLE 853
gi 847168938  732 EMKNVRENETALRTKLQEEQLKRKVLEQSCQDLKHQMGILFDKETVLTRNNSalq---hkIhqqesqllnldDVQTVS-- 806
gi 971429614  860 ELKEARENEARVQQELREELLKRKLLEQQVEELRQQLRHSHETEASLakmh------velQ-----------AKTLHALE 922
gi 821475919  395 AIKEARKNETKLKMQYQEEQQKRKLLDQSVDELQQHIQYLHAKEALMEQSNSkqqfkiqqQ-----------EVQLQILE 463
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81897685   391 R-------ERRK-C-EEY----V---KSNQELSEKLSNLQQEKEALWQEHGRFLEQLGDHVRNYKDKHHCHKAKLQKVKD 454
gi 556971256 1038 N-------EQVT-AaDEH----QynqRTSQKLSVQLSSCQLETDRLQEELQLVLQQLDTHIRKYNEKQTRHKAKLRRAKE 1105
gi 973210781 1008 A-------EHSA-A-EEEhrhtQ---KANQNLAEQLLSCQQESERLQEELQQVLQQLDLQVRKYDEKQAQHKAKLRKAKQ 1075
gi 597754830  969 N-------ELSAaR-EQQ----RlsqTNCHDLEDQLMSSHQESERLQEELQQALQQLDTNIRRYNEKQSMHKTKLRRAKQ 1036
gi 528517820  959 S-------ELNTaR-EEQ----RsgqKSCHRLEEQLLSAQHESERLQEELKLVVQQLDTNVRRYNEKQSQQKTKLRRAKQ 1026
gi 765124602  748 TelsktreEV------------KesqKSSQKVQEELLVSQQECERLQAELQQVLLQLDANIRKYNEKQTQNKTKLRQAKQ 815
gi 542210765  854 A-------ELSNaR-EEA----KdsqASRQKLQEELLASQQDCKGLQDELQQVLLQLDVHVRKYNEKQSQHKTKLRQAKQ 921
gi 847168938  807 -------------A-KER----IqieNTNQKLTEELLHVQQEKQQLHKEYENILKQLDEYIR------------------ 850
gi 971429614  923 D-------DKKTdS-GEH----LqcqKESQKLSEQLSLLKEENKALYEEGVRLLNQKDLYVRKYNEMQLRHKEKIRRAKA 990
gi 821475919  464 D-------EKKL-S-DEQ----V---KNNQELTEKISVLQQEKDSLRDEYRQFLNQLDVHMRNYNEKHNHHKAKLRKAKE 527
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81897685   455 RLTHELEIRNKRIKELEDETGKLQQKIEMEKVFQGQIMAQNDILLLEKRKLLEQVTDQEELICSSKCTISAFQSKASLLD 534
gi 556971256 1106 VFEQEIKLRDAKNKQLESEIAITKSLSEKEQAWIKKLTTENEQLLLEKRELLQQINEQEEVGRTNNRTISTVQHKMHFLE 1185
gi 973210781 1076 VFVKETSERDGRIQQLENDLALAHSLAEKEQDWIKKVTEENEKLLLEKRHLLKKLSEEEEVGHMNMRTTSTIQHRVNFLE 1155
gi 597754830 1037 LFLKATTQRDLRIQKLESDLALATSLSEKEKDWIRTVTEENDQLLLERRELLKRMTEAEEMGNNGMRTATTTQQRVKFLE 1116
gi 528517820 1027 IFMKTVSQHEQRIQQLENDLALATSLSEKEKDWIRTVTEENEQLLLERRELLQRISEAEEMGNNGLRTATTTQQRVKFLE 1106
gi 765124602  816 VFLKTTAQRDSTIQKLENDLALANSLSFKEKERIQTVVAENEKLLEDKRELLRRISEAEEMGSKGMRTASTVQHRVNILE 895
gi 542210765  922 VFLKATEQRDSTIQKLENDLELASMLSQKDKERIQLVMEVNEKLLEEKRELVQKIIEAEEMGSKAMKTASTVQYRVNLLE 1001
gi 847168938      --------------------------------------------------------------------------------
gi 971429614  991 TFIHEVKQRDSRIKQLENELSESKLQVEKGKALIAQITTENEKLLQERRRLLQRITDQEETPWSNRSTVAALQSRMKILD 1070
gi 821475919  528 RLTNEVEQRDERIKQLENEIEEMQRLMEKEKEFQDQVTTQNENLLIEKRRLLERLTEQDETIQGNKWMISSVQNRVLFLD 607
                         410
                  ....*....|...
gi 81897685   535 KENQQLQENCLRL 547
gi 556971256 1186 EENRQLQDRTLKL 1198
gi 973210781 1156 GENRQLQDRTLQL 1168
gi 597754830 1117 MENNQLQEKTLKL 1129
gi 528517820 1107 MENKQLQEKTLTL 1119
gi 765124602  896 VENRQLHERTMKL 908
gi 542210765 1002 VENKQLQDETLKL 1014
gi 847168938      -------------
gi 971429614 1071 EENMRLHESKLHL 1083
gi 821475919  608 EENKLLQENSLRL 620
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap