2MUQ


Conserved Protein Domain Family
UBZ_FAAP20

?
pfam15750: UBZ_FAAP20 
Click on image for an interactive view with Cn3D
Ubiquitin-binding zinc-finger
This domain is the ubiquitin-binding zinc-finger of the Fanconi anemia-associated protein of 20 kDa.
Statistics
?
PSSM-Id: 318047
View PSSM: pfam15750
Aligned: 9 rows
Threshold Bit Score: 65.5874
Threshold Setting Gi: 762103473
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....
2MUQ_A         9 RSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDV 42
gi 260784672 548 RSCPMCQEEFPPGMSQLETDGHIAACLSASSEDI 581
gi 675890764 207 eqCPICLKEFELNFSQIEKDGHLARCLSGVTDDV 240
gi 762103473 177 sqCPMCGKSFGPSFTMLDVDSHLANCLSATDDDV 210
gi 821477596 219 NGCPMCQQQFTGKLSQLDIDSHLAKCLSESIEDV 252
gi 537222630 138 LSCPLCQKAFDPTLAQMDVDSHLAQCLAESTEDV 171
gi 166991448 157 QSCPMCQVDFAPGLAQLDIDGHLAQCLADSTDDI 190
gi 808884775 246 QSCPMCLLVFPAGFTQMDCDGHLAQCLSEVNVDM 279
gi 731492536 295 VCCPMCQAEFSPRLSQLDIDAHLAQCLAESTDDM 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap