Conserved Protein Domain Family
DUF4689

?
pfam15755: DUF4689 
Domain of unknown function (DUF4689)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 202 and 224 amino acids in length.
Statistics
?
PSSM-Id: 318051
View PSSM: pfam15755
Aligned: 8 rows
Threshold Bit Score: 273.275
Threshold Setting Gi: 126335567
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882587    1 MPATPQQPSGHTEGltEPTSEAAMWVVIPCGPCIPIMLGLASLTAFFIITTAVLAERLFRR-PQPDP-SQRAPTLVWRPG 78
gi 126335567   1 MSAPLEQLPGQVEN--PVMHQPSQWPPILCGPCIPIMLALALLAAIFLLATAVLAERLFRRsLRSDP-SVGRPSLVWRPG 77
gi 338712722   1 MPSTPGQPSEHMEG--PPVLEAASWPPLPCGPCIPIMLALASLSALFLLTTAVLAERLFRRsPQPDP-RNQAPTLVWRPG 77
gi 344294384   1 MPSTPGQPTGHMEG--PPASESASWSPLPCGPCVPIMLALACLAALFLLTTAVLAERLFRRsPRLDP-SNRTPTLVWRPG 77
gi 302565778   1 MPSTPEPPSGRMEG--PPTWEAAPWPSLPCGPCIPIMLALATLAALFILTTAVLAERLFRRaLRPDP-SHHAPTLVWRPG 77
gi 532076218   1 MPATRGQPSEHMEA--PSASETALWPPLPCGPCIPIMLALASLAAFFILTTAVLAERLFRRsLRADPgTHHAPTLVWRPG 78
gi 884939830  18 MPSTSTRLTGHMEG--PPATEATFWPPLPCGPCIPILLALASLAAFFILTTAVLAERLFRRsLHPDP-SHRVPTLVWRPG 94
gi 511909045   1 MPSTPEQPFGHTGG--LPVPEMGSWPPLPCGPCIPIMLALASLAALFLLSTAVLAERLFRRsQHADP-SHHAPTLVWRPG 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882587   79 GELWIEPTSSARERSEDWYGSSIPLLMDRAPDPPTPGGTLEGRATAppaIPTPH------PSPSSLVPQTPPEVPAqSTF 152
gi 126335567  78 GELWIEPVGTPHERSEDWYGAIAPLLHSQVTEATIPRGTLEAQATA---PPNPD------SPPCPSVLPWAPESPG-STF 147
gi 338712722  78 GELWIEPTGTPRERSEDWYGSAVPLLRDQAPDPPTPGGTLEARATAppaSSAPH------SPPRSLVPQTPPKVLAhSTF 151
gi 344294384  78 GELWIEPTGTPRERSEDWYGSAVPLLMDGAPEALNPGGTLEARATApsaPSAPH------SPPSSLVFQAPPQVPArSTF 151
gi 302565778  78 GELWIEPMGTPRERSEDWYGSAVPLLTDRAPEPPTPVGVLEAQATApyaPSAPN------SAPSSLGPQTSPEVPArSTF 151
gi 532076218  79 GELWIEPTGTARERSEDWYGAAVPLLSGRAPDPPTPGGTLEAQASAplaPLAPH------SAPSSLVLQTPPEVPAqSTF 152
gi 884939830  95 GELWIEPAGTARERSEDWYGCEEPLLTDRSPDFPPPGGTLEARASAppaPSALH------SSPSSSVPQEHPNILAqSTF 168
gi 511909045  78 GELWIEPRGTPRERSEDWYGSAVPLLMDRAPDPPTPGGTLEARATAppaPSAPPtplaplTPPSSLGPHTPPRAPVrSTF 157
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 81882587  153 WRPQTQEESPYATGLVSWVGPEPMAEAgleVGSPRAWRLRQGSLEPDWSLQPRVTLEQISAFWKREGRTSVG 224
gi 126335567 148 WMANPWEERPRTTGLVGWCEPQPGPEP---LSSPFYGSHRPGSPEPDWGLQPRVTLEQISAFWRRENRVGGG 216
gi 338712722 152 WGPQVGEERPHAPGLVSWAEPEQGPVAsvyLGSPQSRRQRPGSPDPEWGLQPRVTLEQISAFWRREGRTSVG 223
gi 344294384 152 CVPQPWEERSHNTGMVSWAEPEPRPGDsvyLGSPRAQRHRPGSPEPGWGLQPLVTLEQISAFWRREGRTSVG 223
gi 302565778 152 WGPQPWEGRPPGTGLVSWAEPEQRPEAraqFGSPQARRQRPRSPDPEWGLQPRVTLEQISAFWRREGRTSVG 223
gi 532076218 153 WGPQPQEERPHATGLVSWAEPELRSEVsmqLGSPKAWRQRPGSPEPDWGLQPRVTLEQISAFWRREGRTSVG 224
gi 884939830 169 WGPQPCGERPPTTGLVSWVGPELRPEAtpmLGSATAWRPRPGSPEPDWSLQPRVTLEQIAAFWRREGRTSVS 240
gi 511909045 158 WGPQALNERPCAPGLVSWAEPEHRPEAtvhLGSPQAQRQQLGSPDLEWGPQPRVTLEQISAFWRRESRTSVG 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap