Conserved Protein Domain Family
DUF4690

?
pfam15756: DUF4690 
Domain of unknown function (DUF4690)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 100 and 122 amino acids in length. There are two conserved sequence motifs: LGPGAI and LRKF.
Statistics
?
PSSM-Id: 318052
View PSSM: pfam15756
Aligned: 8 rows
Threshold Bit Score: 92.9465
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81904335   26 EGPQEPDPTLWNEPIELPSGEGPLE-STSHNQEFAVSGPPFPTSAPAPEDSTPPARVDQDGGSLGPGAIAAIVIAALLAT 104
2_pfamImport   1 EYPQGPFPTLWNDPPELPSGGGPLE-TTPSPRFSDSPGFPPYTSDYEPEDTTHLHQLDNGNGSLGPGAIGAIVIAALLGT 79
3_pfamImport   1 EYPQGPVPTLWNDPGELPSGVGPFE-STTHSHASDATDLPVYTSEYEPEDTTHLHRLDNETGSLGPGAIAAIVIAALLGT 79
4_pfamImport   1 DVPQEPVPTLWNEPAELPSGEGPVE-STSPGREPVDTGPPAPTVAPGPEDSTAQERLDQGGGSLGPGAIAAIVIAALLAT 79
6_pfamImport   1 EYPQGPVPTLWNEPPELPSGAGPFDaATTTARLSDATAFPPYTSELEPEDTTHLHRLDTGDGSLGPGAIGAIVIASLLGT 80
7_pfamImport   1 ETAADPAPTPQSESQETCSGGGSYD-VTTRDPPHDLTD---NTFTFEYEDTTHSQPMDRG-GVLGPGAIAAIVIAVILGA 75
1_pfamImport   1 ETVADSSPTFQKD--DTVSGDGSFD-VTTK--AQELIE---STVIADYEDSTHIITLEEE-VVLGPGAIAAIVIAVFLGA 71
gi 348501250  27 DTVSDTAPAT-RDNQDTVSGDEPPS-DTTT-KPPYLTDPP---STIDYDDATEV--FNEEEGAMGPGAITAIVIAVFLGA 98
                         90
                 ....*....|....*..
gi 81904335  105 CVVLALVVVALRKFSAS 121
2_pfamImport  80 SVIVALIVITLRKFSAS 96
3_pfamImport  80 SVVLALIVITLRKFSTS 96
4_pfamImport  80 CVVLALVVVALRKFSAS 96
6_pfamImport  81 SVLVALVVITLRKFSAS 97
7_pfamImport  76 SVLIALVVITLKRFT-T 91
1_pfamImport  72 SVLLALIVITLRKFTAS 88
gi 348501250  99 SVLLALIVITLRKFTAS 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap