Conserved Protein Domain Family
TMEM108

?
pfam15759: TMEM108 
TMEM108 family
This family of proteins is found in eukaryotes. Proteins in this family are typically between 258 and 575 amino acids in length.
Statistics
?
PSSM-Id: 318054
View PSSM: pfam15759
Aligned: 8 rows
Threshold Bit Score: 526.882
Threshold Setting Gi: 528519401
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 344249540   14 VMTRNPKPD-----GPsSQAAATMETTVSHPEGYPPTDTVSTV-VTAAIPHPESPLPTGSPPAAM--ATTASHSEGRPPG 85
gi 351708557  104 VVTLGPAPD-----GP-SQATATMATTIPHQDRHPPINTTSTViVTANIPHSESPLPTGSPPVTM--ATIASHSESRPPG 175
gi 1034159439  63 VVMLTPNPD-----GPpSQAAAPMATPTPRAEGHPPTHTISTIaATVTAPHSESSLstgpaPAAM--ATTSSKPEGRPRG 135
gi 395832810   63 LVTLTPHPD-----GPsSQATAPMGTT-ALPDGHPPTDSVSTIvATATSPHSERPLPTGPPPMAM--TTTTSHSEGRPPG 134
gi 528519401   13 YSPLENHEHcgggaGPhDTMKRSLQVL--------PHQLLSILlILFV-------------PAGLvfSTEELHP------ 65
gi 731508616   66 VAMLSSHDD-----GPsSQTIRPRATTMPYPDRHPPVNTIPTImVTETTPNPEGPLHTWPPPAAM--ATTSSHLEGHPLG 138
gi 345789189   70 VVTLTPHPD-----GPsSQATAPMAMTTPHPDGHPPTNTISTItVTATTPHSEGPLPTEPLPAAM--ATTSSYSEGHTQG 142
gi 584079473   65 sMTLSPRPD-----GPfSQAEATVAAATPYPEGYPPANTASTTmATATVHHADGPLSTGPLPAATatATATSHPEGRPLG 139
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 344249540   86 DATPTILPTKPAGATSRPTMSP-RSTTRRAPRPPGSSRKGASGSSRPLLPVPSGHSARKEGQRGRNQSSTHLGQ----KR 160
gi 351708557  176 DAAPTILLTKPTGTTSHPTTAApRAITRRPPRLPGSSRKGTGASLRPVPPAPGGHSGRKEGQRGRNQSSTHLGQ----KR 251
gi 1034159439 136 QAAPTILLTKPPGATSRPTTAPpRTTTRRPPRPPGSSRKGAGNSSRPVPPAPGGHSRSKEGQRGRNPSSTPLGQ----KR 211
gi 395832810  135 EATPTILLTKPPRATSHPTTASpRAATRRIPRPPGSSRKGAGSSARPVPPVPGGHAGRKEGQRGRNQSSTHLGQ----KR 210
gi 528519401   66 ------------------------S------QPPR-DLVSMSTSSRTLSP---GLLSWQEGSSTGNLHNQALASleaiRR 111
gi 731508616  139 EVVPTILLTKPMGATSRTTTAPtRSTTRRPPRPPGSSRKGAGSSSRPVSPASSGPLGRKESQRGRNQSSTHqGQ----KR 214
gi 345789189  143 EAVPTILLTKPTATTSRPTTAPtRATTRRPPRPPGSSRKGANSSSRSVLPAPSGHSGRKEGQRGRNQSSTHLGQ----KR 218
gi 584079473  140 EAGPTILLTKPPAATSRPSPAPtRGATRRPPRPPGSARRGAGGSSRPVLPALGGPSGRKEGPRGRNQSSAHLGQ----KH 215
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 344249540  161 PLG-KIFQIYKGNFTGSV-----------------------------EpdpsalSPrtplwgYSSSPQPQTVSPATALRS 210
gi 351708557  252 PLG-KIFQIYKGNFTGSL-----------------------------E------TP------YFSLPQPQTVAATTAPRS 289
gi 1034159439 212 PLG-KIFQIYKGNFTGSV-----------------------------EpepstlTPrtplwgYSSSPQPQTVAATTVPSN 261
gi 395832810  211 PLG-KIFQIYKGNFTGSM-----------------------------EpepsalTPrtplwgYPSSPQPRTVTTTTAPSS 260
gi 528519401  112 PTAvDFFQTPKTTVPSAIvqtttvgvhhfapreqaqpgiplnkaevpEltpgsiFSrtnskvFSTRTQDQNFSTNTDKPS 191
gi 731508616  215 PLG-KIFQIYKGNFTGSV-----------------------------EpdpfalTPrnplqdYSSSPQTQTVAATTVPNS 264
gi 345789189  219 PLG-KIFQIYKGNFTGSV-----------------------------EpdpstlTSrnplwgYSSLPQPQTVATTMAPSR 268
gi 584079473  216 QGV-RASQVLRGNATGSA-----------------------------EpepstlAPw----nSSSSPQPQMVAAATVPSR 261
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 344249540  211 TSWVPPTTSLVPAK-------DKPGL----IRANQGSGPTFTSAAGEPDA--TAASGAPAST-QPAPVPSQ----SPH-G 271
gi 351708557  290 TSWVPPTTLLVPAE-------DKPGL----STADQGGGSIFTSPGRELNT--TAAAGAPISS-QATPVPSQ----HPH-S 350
gi 1034159439 262 TSWAPPTTSLGPAK-------DKPGL----RRAAQGGGSTFTSQGGTPDA--TAASGAPVSP-QAAPVPSQ----RPHrG 323
gi 395832810  261 TLWAPPTTPLVPAE-------DKPGL----HTATPGGGSTITSRRGEPDT--TAASGAPASP-RPAPVPSQ----RPH-S 321
gi 528519401  192 TISRKPVNQFEPSGllrtnqiSTPGLvsgqRATNSGSGHSFVS-GTEHDVadTEKMSKPIDPiQHQSSPSSfslfKAHrS 270
gi 731508616  265 TRGIIH-HPLVPVE-------TKPGL----SRADQGGGPTFTSQGGELNA--TAASGAPSSP-QPAPVPSQ----RHH-S 324
gi 345789189  269 TSWAPPTNPLVPTE-------DKPGL----SRAGQGDGSTFTSQGGELDT--TVASGAPASP-QPAPVPSQ----HPR-G 329
gi 584079473  262 TTWAPGTTPLVRTE-------GKPGL-----RADQGGGPTLTSPGGQPDS--ATASGAPASP-KPAPVPSP----RPR-G 321
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 344249540  272 DVQDSPSHSDSW----LAVTPDTDRPLSASSRVFtaatxxxxxxxxxxxxxxxxxxxsmfcTAATGPTQAAFDTSVSVPS 347
gi 351708557  351 DTQDSPSLSDSW----LTVTSVTNRPLSASSKVF---------------------------TAVIGPSQAAFNATVSAPS 399
gi 1034159439 324 DPQDGPSHSDSW----LTVTPGTNRPLSTSSGVF---------------------------TAATGPTPAAFDTSVSAPS 372
gi 395832810  322 NAQGGPNHNDSW----LTVSPSTSRPLSASAEVF---------------------------TTTMGPTQAAFDASVSAPS 370
gi 528519401  271 QNVNKVSAQHTItlrsLSITENPTLPLDTVGGALa-------------------------qTYIQSPPPA-----LAPPS 320
gi 731508616  325 GPQDGPSHSNSL----LTVTTGTNRRLSASSGVF---------------------------TTATGPTQAAFDASVSAPS 373
gi 345789189  330 DPQDGPSHSDSW----LTVTPGINRPPSTSSGVS---------------------------TATAGPTQAAFNASVSAPS 378
gi 584079473  322 DPHDSSSHSDSW----LPVTPGTGRPLSASSGGS---------------------------TAAPGPPQAAFDASVSAPP 370
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 344249540  348 QGIPQGTS----ATPQAPTWPSGVSESTVS--LAEEKAEASPTTTDRG-----PRALSTVLSTATGNFLNRLVPAGTWKP 416
gi 351708557  400 QGIPQGTS----TTPQAPAHPPGVSESTVS--LAEEEAAASPFMTDRV-----PSPLSTVVSTATGNFLNRLVPAGTWKP 468
gi 1034159439 373 QGIPQGAS----TTPQAPTHPSRVSESTIS--GAKEETVATLTMTDRV-----PSPLSTVVSTATGNFLNRLVPAGTWKP 441
gi 395832810  371 QGIPQGAS----TTPRAPTRPPGVSESTVS--PAREEATATIPVTDRV-----PSPLSTVVSTATGNFLNRLVPAGTWKP 439
gi 528519401  321 NHISTESS----NTVEVGTN--GTTNMTVEflISPTNATDVLNSTDSLrpaanDSDMSEVPSTDSGSFMNRQVPATTQGP 394
gi 731508616  374 KGIPQGAS----TTPRAPTRPPGFSESTVS--QAEEEATATSSMTGRV-----PSPLSTVVSTATGNFLNRLVPAGTWKP 442
gi 345789189  379 KGTPQGTS----STSQAPSHPTEGSESTIS--QAKEEATATPTMTNRV-----PSPLSTVVSTATGNFLNRLVPAGTWKP 447
gi 584079473  371 EGLPQGTSsatpSAPRAPAHPPGASESTVP--QAEEEAVAAPSMIARL-----PRPLSTVVSTATGNFLNRLVPAGTWKP 443
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 344249540  417 GTVGNISHVAEGDKPQHRATICLSKMDIVWVILAISVPISSCSVLLTVCCMRRRKkTANPENNLSYWNNAITMDYFNRHA 496
gi 351708557  469 GTAANISHVAEGDKPHHRATICLSKMDIAWVILAISVPISSCSVLLTVCCMRRKK-TANPENNLSYWNNAITMDYFNRHA 547
gi 1034159439 442 GTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPISSCSVLLTVCCMKRKKkTANPENNLSYWNNTITMDYFNRHA 521
gi 395832810  440 GTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPISSCSVLLTVCCLRRKKkAANPEHSLSYWNNAITMDYFNRHA 519
gi 528519401  395 WGSGNQSGPALG-PPHEKNTICLDKMDIVWLVLAISVPVSTCSVLLTVCCMRKKKkSASQENNLSYWNDAITMDYFTRHA 473
gi 731508616  443 GTVGNISHVAEGDKPQHRATICLSKMDIIWVILAISVPISSCSVLLTVCCMRRKKkTAKPENNLSYWNNAITMDYFNKHA 522
gi 345789189  448 GTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPISSCSVLLTVCCLRRKKkTANPENNLSYWNNAITMDYFNKHA 527
gi 584079473  444 GPAGNISHVAEGDSPQHRATICLSKMDIAWVVLAISVPISSCSVLLTVCCLRRKKkAANPENNLSYWNNAITMDYFNKHA 523
                         570       580       590       600       610
                  ....*....|....*....|....*....|....*....|....*....|....
gi 344249540  497 VELPREIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI 550
gi 351708557  548 VELPREIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI 601
gi 1034159439 522 VELPREIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI 575
gi 395832810  520 VELPREIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI 573
gi 528519401  474 VELPREIQSLEAEE---QETCLPPNGDYSDSGVVLVNPFCQETLFINRDKASDI 524
gi 731508616  523 VELPREIQSLETSEDQLSEPCSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI 576
gi 345789189  528 VELPREIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI 581
gi 584079473  524 VELPREIQSLTTSEDQLSEPRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI 577
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap