Conserved Protein Domain Family
DUF4691

?
pfam15762: DUF4691 
Domain of unknown function (DUF4691)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 71 and 317 amino acids in length.
Statistics
?
PSSM-Id: 318057
View PSSM: pfam15762
Aligned: 13 rows
Threshold Bit Score: 160.462
Threshold Setting Gi: 81905111
Created: 6-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905111     1 MASEGAKRQPETQ----NGAAVGLAQVAES-------LECPg---tEECLVPAHETCRSPGEDKCPVGHSLEPELQeEGI 66
gi 440905437    1 MDSAGAEKRPGAQ----EGIAVGQSQLTEVagghaqnSECPvm--rDQCLVPAHESCQTQGEDKCPIRSTSEQKIQ-ERL 73
gi 545211537    1 MASAGAEKRPGTQ----EETAVGPAQLAEAlggcarsSECpvmg--eqcLVPAHGACQTQSADKCPAGSVSEPLLQqERL 74
gi 532065048    1 -mASGAERKPGAP----EGTVAGLVQVVEApvnhaqsLECSmm--gDQCPVPAYEACSTQGEDVCPTGHCREPELQeEGI 73
gi 351714112    1 MVSAEGKKCPGAQ----EGSAVGQAHVTEVrcghaqrPEVTevvtgDQCLVPVQETCRTQDEDKRPAGHCSEPNHQeEGL 76
gi 927226048    1 MASAGDERRPGTQ----EKTAVGLAQLTEVptgyaqnSECPvm--gDQCLEPALVACQTQGEDKCPTGAVSEPELLeERL 74
gi 344240950    1 MASAGAQRQPDAQ----NGATVGLAQLAEI-------TECPgpgpgEKCLVPAHETCRTPSEDKYSVGHSFEPELQeEGI 69
gi 1040221481   1 MASAGAERPPGAQ----EGVAVGPAQLVKAps---grSECPvm--eAQCLEPAYEACRTPGADRCPRGHASEPELQ---- 67
gi 395853897    1 MASAGAEKQPGPQ----E--AMGPPQLPEVpsgcpqtSECLvt--gNQCPVPAHEACQTRGEDKCPTGVASEPELQ-EGL 71
gi 125628665    1 MASAGAERRPGVQ----EATVVGQGQLTEEpgs-aqtSECPva--gDQFLVPAHEARGTQSEDQRPAGAASESELQeEGP 73
gi 928135594    1 MASAGAERRPGAP----EGTAAGPAQLSESsgghaqsSECPvm--aDRCLVPAYEACRTLGEDKGPAGPVSEPELQeEQL 74
gi 1126482359   1 --------------------------------------------maDQCLVPHYEACQTLGEDKCPTVQVSEPELQeERL 36
gi 940759109    1 MASAGTERRPGAQegtaEGTAEGPAQLSEAprghvqsSECPvm--gDQGLVSAHEVCGTQGEDKRPTGPVSEPELQeERP 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905111    67 KVGEEGLNAGVEAGEERG-PKPTSSIVRPAHGPKR-----------------KSEVELPPG-VLQKKEEPEGSHSESSLS 127
gi 440905437   74 KLEEDRHKPEVEALEERG-PRPMASTVRPSHGPKRkpvnlag---pshqahpRAESELPQG-LSLQREEPENNQSEPSPT 148
gi 545211537   75 KLEEERLKPEVEALEERG-PRAMGSTVRPSHGPKRklvnlpg---pshqahpRAEAELLQG-LPLQREEPESSQSEPSPS 149
gi 532065048   74 KLEEEVL--EAEAGDERG-PRLGASIVGPSHGLKRkpikgmslpgpsyhahpRTEAELPPG-MLLQREELEGCQNEPSPS 149
gi 351714112   77 K-QETGLEPEAEAGEEKG-PRPVGITERPSHGLKkpvnh---------hvhpRTEAKLPRGtLLLKREEPEGSQNEPSPS 145
gi 927226048   75 KMEEKRLKPVAEALEERG-PRPITSIVKPNHGPKRkpvnlpg---sshqahlRAEAELPQG-LLLQKEELENSQSEPSPS 149
gi 344240950   70 NRGEEGLNPGVEAGEERG-PKPTSSIVRPSHGPKRkp--------------iKAEAELPPG-LLLQKEEPEGSHSESSLS 133
gi 1040221481  68 ---ERALKPQVEAPEEKG-PRPMASPMRPGHGPKRkp--------------vKVEAELSPG-LLLQREESEGSQSEPSPS 128
gi 395853897   72 K-QEERLKAEREAPEERS-PRPAASLVRPSHCPKRkpvkslslpgpshhaypRTEADLPPG-LPLQKEEPEGSQSEALPS 148
gi 125628665   74 KLGEERPKPHAGALEERG-PRPVVSIVRPRHGPKRkpvkslsl--pglrahlKAEAELPPK-LPLQEEEPEDSQSEPSPS 149
gi 928135594   75 RLEEERLKLEVESLEERG-PRPTASVVRTSHGPKRkpvnfpg---pshqahpRVEVEMPQG-LPLQKEEPESSQSEPLPS 149
gi 1126482359  37 KLKEERLKPEVESLEERGpPRPMVSIVRPSPGPKRkpvnlpg---pshqvhpKAEAEMPQG-LPPQREEPEGSQTEPSPS 112
gi 940759109   79 KLEEERLKPEVEALEERG-PRPMASVVRSSHGPKRkpvnlpg---pshqahpRAEAELPQG-LPLQREDLEGSQSEPSPS 153
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 81905111   128 SKQHKKAKKRKSGGAPVPPAVASASAPAAETLGLE 162
gi 440905437  149 AKQHKKAKKRKSLGTPVLPVVASTVSAPSVTLGPE 183
gi 545211537  150 AKQHKKAKKRKSLGAPVLPAMASTVSAPSETMGLE 184
gi 532065048  150 AKQHKKAKKRKSLGAPMLPAVASTMSAPPETLGLE 184
gi 351714112  146 AKQHKKAKKRKSLGAPVLPAVASTVCAPPEKLerk 180
gi 927226048  150 AKQHKKAKKRKSLGTPVLTVVASTVSVPSETLGLE 184
gi 344240950  134 AKQHKKAKKRKSVGAPVPPALAGT-STPTETLGLE 167
gi 1040221481 129 PKQHKKAKKRKSLGAPVLAAMASTVPAPSEALGPE 163
gi 395853897  149 AKQHKKAKKRKSLGAPMLPAVACTVSAPSEALGLE 183
gi 125628665  150 AKQHKKAKKRKSLGAPVLHAVASMVSAPLETLRLE 184
gi 928135594  150 AKQHKKAKKRKSLGAPVLPAMTSTVSAPSETLGLE 184
gi 1126482359 113 AKQHKKAKKRKSLGAPVLPAVASTVSAPPETLGLE 147
gi 940759109  154 TKQHKKAKKRKSLAAPVLPAVASTASAPSETLGLE 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap