Conserved Protein Domain Family
DUF4693

?
pfam15764: DUF4693 
Domain of unknown function (DUF4693)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 238 and 436 amino acids in length.
Statistics
?
PSSM-Id: 318059
View PSSM: pfam15764
Aligned: 13 rows
Threshold Bit Score: 359.881
Threshold Setting Gi: 874488229
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147639235 146 PAKDL-PGHRLLLVGDGAHMGQGAGANK--------PEAGLRDQQIVPQAASQVPEAFTLKDKGALLRLPEAFRKAASRN 216
gi 81891605  150 PPKDY-PEHRLRSKGDKTHVRTQDQTTG--------YGPDLRDQQMTPSSAHHTTELFALKEKGTLLQLPEDFRKAVSRN 220
gi 821469668 186 PQGQV-PE---LPTPTPVSVLKEAGATG--------PNPRPEQAKIQPGLA---PEAFLLKDKGTQLQLPLSYKKIASRN 250
gi 874488229  96 salkeqqssirySVGERNLVAAGRQLIDagkkscgsPGESSRKENPTAEGGSTSPRTVTIQQQGCQLKLPHPYRKAYSRN 175
gi 731503472 115 PARSL-PEHRLLSTRERTSLGRGARATR--------PSLG--DQQVTPSVTPLVPEAFTLKEKGTLLRLPMAFWKAASQN 183
gi 558179727 139 PAKGL-PKPRLLSAADQTCTGRGPLAAK--------PGPDLRNPQIAPSAAPQAPKAFTLKEKGTLLQLPMAFRKAASQN 209
gi 989959206 144 hAKGL-PDRRLLAVGDHSCLGRGAQAAK--------TGPGPREQQTFPSVAPQAPEAFTLREKGTLLRLPMAFRKAASQN 214
gi 335284858 147 PAKNL-PEHRLLSVADATCKRRGAQAVK--------PEPGLRDQQMVPSAAAQAPEAFMLKDKGVLLQLPVAFRKAASQN 217
gi 301782333 147 PARGL-PECRLPSVGDHTAMGRGSRATK--------PGPGLRDQQIPPSAAPQAPEAFTLKEKGTLLKLPMAYRKAASQN 217
gi 444727326 365 PAKVC-PEHKLLSAGKRTHAGIGAQA----------PGPGLRNQQVASSAAAQVPETFTLQEKGSMLQLPVAFSKAASRN 433
gi 354494936 152 PSRSAdPECRRRSRGDRTQERTEAQVTG--------SGPGLRGQQMAPGAVPPSTELFTLKEKGTLLQLPVAFRKAASQN 223
gi 514477059 151 PTKGH-AEHRLPLVRNRSHVGLGAQATR--------LELN-HGKKMTLSPAHHTAETFTLKEKGTLLKLPLAFRKAASRN 220
gi 114660465 148 PAKGH-PERRLLSVGDRTRVGMGARTPR--------PGAGLRDQQMAPSAAPQAPEAFTLKEKGHLLRLPAAFRKAASQN 218
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147639235 217 ARlpmcassLWAQ-----LSSMQTRDSVDaAAATAKTQFLQKMQTAAGL--PSSMLSA----AEVGRLQKACSMLRLRMR 285
gi 81891605  221 SC-------LWAQ-----LNSARTNDSTD-ATRAAKTQFLHKLQMASGC--SSHRPSAteveAHARILRKACMLLRLRMQ 285
gi 821469668 251 SS-------LWAQ-----VQHLQSNPDPD--VAAAKARFLERMKGTFDL--PSPSLSLakvqEEVSRLDQACHILTQHLE 314
gi 874488229 176 CR-------AWER-------SRLCQTSAD--AAAARKRFTERIQTTFEFcsPMPALSPaeieEELKVLQDVPSLLRQYVE 239
gi 731503472 184 AH-------LWAQ-----IDSTQASDSAN---ATARTRFLLKMQAASGW--PGVGLSAavveAEVGRLRKACLRLRLRMG 246
gi 558179727 210 SC-------LWAQ-----LSSTQTSDSTD-ATTSSKTQFLQKMQvtSGW--PSSGLSAaeveAEVGRLQKACLLLRLRME 274
gi 989959206 215 SR-------LWAQ-----LSTAQTSDSMD-AAMTSKTQFLQKMQTRSGW--PCSGLSApemeAEVGSLWKACSLLRLRMG 279
gi 335284858 218 SR-------LWAQ-----LSSAQTSDSAD-AAATAKAQFLQKMQTASG------WPSAteveAEVGRLQKACSLLRLRME 278
gi 301782333 218 SR-------LWAQ-----LSSTRTSDCGD-AATTAKTQFLQKMKMTSGS--PGSGLSAaqveAEVGLLRKACSLLRQRME 282
gi 444727326 434 SRg------AWSRsleisLTCVQ-----------------------PGQ--PSAGLSAtevqEETQRLRRACSRLRLHML 482
gi 354494936 224 SR-------LWAQ-----LSSIQASDSTD-VTRAAKTEFLHKLQMASGS--SSHRPSAaeveAHVQSLRKARTLLRLHMQ 288
gi 514477059 221 SC-------LWTQ-----LNSTQTNDSTD-ATSAAKTQFLQKMQISSST--SSSKFSAveieMETQRLQKACALLRRRMQ 285
gi 114660465 219 SS-------LWAQ-----LSSTQTSDSTD--AAAAKTQFLQNMQTASGG--PQPRLSAveveAEAGRLRKACSLLRLRMR 282
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147639235 286 E------ELTADPKDWTQEYRSLLTLEGLQALAGQCLHRlqeLQELRS------------AVVEQP---------QGPWP 338
gi 81891605  286 K------ELAIAPTDWMQEYRCLLTLEGLQTVVGQCLHR---IQVLQA------------AVTEQL---------PGECL 335
gi 821469668 315 EtlegdgELSAASLSWEQEYRRLVTLEGLQAAVKRHLLK---LQELREgyrpsrdsagskDIPEEYy--------LGSRT 383
gi 874488229 240 A------EPADHPT-LQREYESLLTLEGLQSTVSQCLRK---LQLLQA------------AVESQKrlhpdctgdVGSCC 297
gi 731503472 247 T------ELAAAPTDCVQEYRCLLLLEGLQATVGQCLHW---LQELRK-------------------------------- 285
gi 558179727 275 E------ELTRDPTDWMQEYRGLLTLEGLQAIVGQCLHR---LRELQA------------EVVEPQ---------LGPWP 324
gi 989959206 280 Q------ELAADFTDWMQEYRCLLTLEGLQAIVGQCLHR---LQELQT------------VVVEQQ---------QGLWP 329
gi 335284858 279 E------ELMADPEDWAQEHRCLLTLQGLQDMVGQCLHR---LRELHP------------AVGEQL---------LRPWP 328
gi 301782333 283 E------ELSAEPADWMQEYHCLLTLEGLQx-----LHR---MQELRA------------AVAGQQ---------LGPWP 327
gi 444727326 483 E------ELSAAPADWMQEYRCLLTLEGLQALAGRCLHQ---LQELRA------------ATEGQ------------PCP 529
gi 354494936 289 K------ELSTAPTDWMQEYRGLLILEGLQTIVGQCLHR---VQVLQA------------AVTEQL---------PGLHL 338
gi 514477059 286 E------ELSAAPVDWMQEYQCLLILEGLQTMAQQYLHK---VQELCT------------ALTEQL---------PGSNL 335
gi 114660465 283 E------ELSAAPMDWMQEYRCLLTLEGLQAMVGQCLHR---LQELRA------------AVAEQP---------PRPCP 332
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147639235 339 EG-PPRAALPCGGGADPVWSPQLLLYSSTQELQTLAALRLRVAMLDQQVHLEKVLMAELLPLLSEQEPLGRPWLALCRAA 417
gi 81891605  336 AEtRTQASSVCGGEVDSACSPELLLYASTEELQTLATLKLQVALLHQQIHLEKVLMAELLPLINTQDPGGPPWLALCRAA 415
gi 821469668 384 VEnFTWDSPPCLGGKGLSGPTNRLVYSSVQELQTMTALKLHVTMLKQQIHLQKVMMEEFLPLVRSETPADPAQLALYRAI 463
gi 874488229 298 PAcVPARGRSCGGAGTLAVP--LLWYSSFQELRDLFALKLQVSMLHQEIALQKLTMTELLPVLESEACPEASAAQLYRAI 375
gi 731503472 286 -GmPARASCLCEGGADAAWSPQPLLYSSTQELQTLAALRLRVAMLDQQLHLEKVLMDELLPLVRTQRPC---CVAVCRAV 361
gi 558179727 325 EErLPMASLPCGGGADPTWSPQLLLYSSTQELQTLAALRLRVDMLDQQIHLEKVLMAELLPLVSMQEPLGPPQLALCRAV 404
gi 989959206 330 EErLPRTSLPCGGGTVPTRNPQLLLYSSTHELQTLAALKLRVAMLDQQIHLEKVLMTELLPLVTTQEQLGLPQLALCRAV 409
gi 335284858 329 EGrLPRASSPCGGGADPVWSPQLLLYSSPQELQTLAALRLRVAMLDQQIHLEKVLLAELLPAVSKPEALGPRWPALCRAV 408
gi 301782333 328 EGrCPSASMPHGGSTDPAWSPQLLLYSSTKELQTLAALRLRVAMLDQQIHLEKVLMAELLPLVSKQDPQGPPWLALCRAV 407
gi 444727326 530 VErPPRAPLPCEGRVDPSWRPWLLLYSSTQELQTLAALRLRVAMLGQQLHLEKVLMAELLPLVCTLEPRGPPWLALCRAV 609
gi 354494936 339 VEkPTQASSLGGGEMDTSWSPELLLYSSTEELQTLATLKLRVAMLDQQIHLEKVLMAELFPLINTQEAGGSPQLALCRAA 418
gi 514477059 336 MGrPLQASLPSGGHVCTSWGPQLLLYSSTQQLKTLGTLRLRVAMLEQQIHLEKVLMAELLPIVSTQEPQGQPWLALCRAA 415
gi 114660465 333 VGrPPGASPSCGGRAEPAWSPQLLVYSSTQELQTLAALKLRVAVLDQQIHLEKVLMAELLPLVSAAQPQGPPWLALCRAV 412
                        330
                 ....*....|....*....
gi 147639235 418 HCLLCEGGQRFLTVLQDEP 436
gi 81891605  416 YSLLCEGGERFLTVLRDDP 434
gi 821469668 464 HSQLCEAGECFSVLVRDEP 482
gi 874488229 376 YTQLCEGGKRFPVLVRDEL 394
gi 731503472 362 HSLLCNGGQHFPTVLQDEP 380
gi 558179727 405 HSLLCEGGQRFLTILRDEP 423
gi 989959206 410 HSLLCEGGERFLTVLRDEP 428
gi 335284858 409 HSLLCEGGKHFLTVLREDa 427
gi 301782333 408 HSLLCEGGERFLTILRDEP 426
gi 444727326 610 HSLLCEGGERFLTILREDP 628
gi 354494936 419 YSLLCEGGEQFLTVLRDDP 437
gi 514477059 416 HSLLCEGGERFLTVLREDP 434
gi 114660465 413 HSLLCEGGARVLTILRDEP 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap