Conserved Protein Domain Family
DUF4701

?
pfam15773: DUF4701 
Domain of unknown function (DUF4701)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 111 and 520 amino acids in length.
Statistics
?
PSSM-Id: 318068
View PSSM: pfam15773
Aligned: 13 rows
Threshold Bit Score: 613.798
Threshold Setting Gi: 982966267
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755803764   19 GPWDAILEAVRDQLPSLDSDSSLSdcEAEELFIFQRDHTALIPDLSEELAEDPAG-----AWLATV-DGSSEpGAVPVEP 92
gi 291412087   14 SPWDAILQAVKDQLPSLDSSSSDS--GEEELFVFQRKESILIPDLSEELAEDGAGgvesgAWGLAE-GPPPEqLLVPVEL 90
gi 914910337   19 SPWDAILEAAKDQVPSLDSDSSLSdcG-EEPFIFQRNQPVLIPDLAEELAEDPADdndsrIWVPLA-----EpVLVPVGL 92
gi 982966267   14 NPWDAILEAVKHQLPSLDSDSSASdcEDEELFIFQRNQTVLIPDLSEELADDPAG-----AWVTSS-GSPPElAAVPVES 87
gi 545815069   19 SPWDAILEAVREQLPSLDSDSSLSdcEEEELFIFQRDQTTLIPDLSEELAEDCAG-----PWVTPS-GFPPEp-AVHVEP 91
gi 940737701   21 GPWEAILEAVREQLPSLDSDSSLSdcGEEELFIYQRNQTTLIPDLSEELAEDPDG-----AWVAPA-NRSPEpLVVPVEF 94
gi 149750958   21 GPWDAMLEAVRDQLPSLDSDSSLSdcGEEELFIFQRNQTALIPDFSEELAEAPAG-----ASVITAdGSPPEpVAVPVGF 95
gi 625207817   14 SPWDAILKAAKDQLPSVDSDSSLSdcEEEEPFIFQRNQPILIPDLAEELAEDPVGve-sgAWITIGrSSSPEpFLVPGRL 92
gi 1034113871  21 GPWDAILKAVKDQLPSLDSDSSLSdyGEEELFIFQRNQTSLIPDLSEELAEDPADgdksrAWVAAAeESLPEpVLVPAEL 100
gi 675705776   21 GPWDAILKAVKDQLPSLDSDSSLSdcGEEELFIFQRNKTVLIPDLSEELAEDPAEs---rTWAATAeDSLPEpVLVPAEF 97
gi 831227486   27 SPWNAIVEAVKDQLPSLDSDSSLSdhEEEEPFIFQRNETALIPDLSEELAEDLAEdaesrTWVTAAiENPPEpLLGPADF 106
gi 511852615   19 ePWDAILKAVREQLPSLDSDSSLSdcGPDELFIFQRDQTALIPDLSEELAEDPAG-----AWLATA-DGPSEaGVVSVEL 92
gi 73959246    30 GPWDAILEAVREQLPSLDSDSSLSdcGTEELFIFQRDQTALIPDLSEELTEDPAR-----AWLAAV-DGSPEpGVVPAGF 103
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755803764   93 STEPWREWGP--RTEASASLQGGDPGGPIDSCGETSSLLRVPKDTPKWQEDNHGAVSL---ST---QGPHQGLQGEATPS 164
gi 291412087   91 ATQPGSGWTT--RMEDSAAGKGRGPSPPFASHGEISCLPRTATETPMRLEGDLGSKSLntkGS---QSPLWAPQGEATLP 165
gi 914910337   93 ATKPGSGQNA--RTLGLASQEGCS----LETCAETSTLLQTSEETPMLPEGDLGTMSFntkQF---QSPPWDPQGEATLS 163
gi 982966267   88 AMEPWGEWNAwpRPQESAPLEGRAP-------SKSSSLLRMSAETPPRQDDDAGG-TL---NTsasQSPRQGPQGEATRS 156
gi 545815069   92 TPEPWRDYSP--RLRESASLEGRAPGGPLQSCGQSSSHLRMPVEAAAWQE-DEGGKSF---NTsasQSGSQGPQGQATLP 165
gi 940737701   95 SAEPWGEWNV--RMK-----EGKDPGQPLES-GESSSL-RMPEETPTWQEGDLGDMSF---NTkgsPSPPWGPQGEATLC 162
gi 149750958   96 AVEPWTEWDA--RTKDSASLGGRDPGGPLESHGQSSSLLRMSQETPKWQEGEPGRMSF---NTkgsQSPHWGPQGEATFS 170
gi 625207817   93 AIEPRSGQTV--KQKDLALQERRGPGWACQSCVKISPILVEAEEGPPWLEGNLRSLC----NPkgsQSPPWTSQGEDATF 166
gi 1034113871 101 ATEPGGRQNT--RTKDASSQEGRDPSRPFESSGEVSALLGMAEETPRWLEGDLGSLSF---NTkgsQGPPWDPQAEATLS 175
gi 675705776   98 ATEPGSMQNA--RTKDVSSQEGKDPGRPFECSCEVISLLGMAKETPRWLEGDLGRLSF---NTrgsQGPPWDTQAEATLS 172
gi 831227486  107 ATELRSVWNV--RTKDSASQEGRNL-RPFENCGEIFTLLRMAG-----VKSNLGNMSF---HTegsPNPPWALEGEANLS 175
gi 511852615   93 TAGRWSKGGA--KTKGSASVQGGDPDGPVESCGETSSLCQVPADIPTWEEGDHEALSF---ST---QGSPWGPHREATFS 164
gi 73959246   104 TPEPQRQWGT--RTKASASLQGGDPGGPVESCEEASSLLRMPEDTPMWREGNQGA-----------QSHPWGPQEEATFS 170
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755803764  165 PWEGDLKAEPLSAASQtgwaaDYADRRALRKERRKMIEKDILHKVTWDAQDPACSDQSQVEEAPCAAAVAVPRPETPPEG 244
gi 291412087  166 LQEGGRETEPPSTAPP-----DPASRRALRRARRKMIEEDILQKVTRDTQDPACSDQSWAKGAPCQAAKSGPQPQVPPAG 240
gi 914910337  164 P-EGEVGIEPLSAAWQ-----DSAKRRALRRERRKMIEKEMLHKVTWDALDPACRDQ-------CQSTEPGLRSEAPSEG 230
gi 982966267  157 PQEAGLQTEPLGAASQaqegsDAASRKALRRERRKMIEKDILHKVTWDGRNPACPDASRGKEKACDAV------EVPSEG 230
gi 545815069  166 PGEAALQTEGPGAASGapagsDSTNHRSLRRERRKMIERDILHKVTRSARHPACQDPSPVEETPRDTA------EKPPEG 239
gi 940737701  163 LSEEDLRTDP-NAVPCvqkgsDSANRRALRKERRKMIERDLLHKVTWGARGPTCSDHSQVKETPCESASTGPRPGTSSQG 241
gi 149750958  171 PREGDLKTEPPGTASRalkgsDPADHRALRRERRKMIERDILHKVTWDAQSPACSDQGQVKETPCGAAASGPRPEVPPER 250
gi 625207817  167 PLEGQLKTEPs----------DIDKRRALRRERRKMIEKDILQKVTQAAQNSACGGQGQ-------APESGPQPEAG--- 226
gi 1034113871 176 CHEGDPKAEPLSTASQ-----ESVNRRALRQERRKMIETDILQKVTRDACGPTSSDQSGVKEAPCHAAESAPRSKMPLVE 250
gi 675705776  173 CHEGDLKAELPSTASG-----ESVNRRALRQERRKMIERDILQKVTWDACSPASSDQGQMKEVPCPAMESAPRPRIPLME 247
gi 831227486  176 PARRDLNAEPTSATSQ-----SAVDLRALRQERRKMIEKDILQKVTRNAQDPASSGHSGVWEVPCHAAESAPRTELLPEE 250
gi 511852615  165 PWEDDLKTEPPGAASPagwstDSKDHRAPQRERRKMIE-DILHKVTWDARGPACSDRNPAEE-----ATAGLRPETPPEG 238
gi 73959246   171 PWEGNLKTEPPSAASRacwgaDSIGRRALRKERRKMIEKDILYKVTRDARDSACSGQSQVEGASCTAPAAGLRPETPPEG 250
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755803764  245 PREGRLVLSLKQLEEWDLDHILQSLAGREDDRGDRAPGATWWAADRLGR-DHTLLNTQDRLMERLALLGATQSRA-SSAW 322
gi 291412087  241 AQQGPLVLSLQQLEEWDLDYVLQSLAGPEDTQGNRIPGTAWWAADLFRHqGHTVWRDEDELMEQLALLSACQATAsTSAR 320
gi 914910337  231 PREGQLVLSLQQLEEWDLDYILQSLPGREDKQGNGAPRTAWWAADLQQSqAHTASHSQDRLLEQLALLCAVQSGApAPAQ 310
gi 982966267  231 PPGCLPVLSLQELEEWDLDQVLLSLTGREEDRGDGAPGAAWWAAGRLQGqDHTEPSTQDRLMERLSLLCARQSRTaASAW 310
gi 545815069  240 PQRGLPMRSLQQLEEWDLDQVLQSLTGREDDQGDGTPGATCWAADHLEGqDHAEPSTQDRLMERLVLLCARQSRAsPSAR 319
gi 940737701  242 PREGLPVLSLEQLEEWDLDHILQSLTGQEDDRGDGAPRGVWWAADHLQGpDHAKPSTQDRLMEQLTLLCAKQFRAsSSAW 321
gi 149750958  251 PREGPSLLSLQQFEEWDLDHILQSLAGREDDRGDGAPGAAWWAADRLQGrDHAVPSAQERLMEQLALLCTTQSRAsSSAR 330
gi 625207817  227 --EGCPVLSLQQLEDWDLDYILQSLPGRQDCQGDSAPRTAWWLADRCQNqGHTIGLSQDTLLEQLALLCATQSRVcNPTW 304
gi 1034113871 251 PPEGPPVLSLQQLEAWDLDDILQSLAGQEDNQGNRAPGTVWWAADRHQVqDRMVPSAHNRLMEQLALLCTTQSKAsACAR 330
gi 675705776  248 PREGPPVLSFQQLEAWDLDYILQSLAGQEDNQGNRAPGTAWWAADSRQVqDRTLPSAQERLMDQLALLCTTQSGAsAYAQ 327
gi 831227486  251 PQAGLPVLSPQKLEEWDLDCILQSLAGQEDNQENHAPETVWWAANCCQIqDHTVLSTQDKLMEQLALLCASHSRAsVSTQ 330
gi 511852615  239 PREGPLVLSLKELEEWDLDHILQSLAGQEGDRGDRAPRATWWAADRLGR-DQSRPNCQDRLMEQLTLLCAAQSQApS--- 314
gi 73959246   251 SREGPPVLSLKELEEWDLDHILQSLAGREGDRGDRAPGATWWAADRLGR-DRIQPNTQDRLMDQLTLLCAAQSRG-ASAW 328
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755803764  323 KAPADTPQDTKQRETSRRTARMEPGFQAELGLRLASGLQLRvpAEPPTVFIDLRPT---EPLELG-SSe----------S 388
gi 291412087  321 RVPAHTPQEVEEQEAGSRCALTKPGFQAEPGQKAAEGMRLK--MEPPTIFIDLRQT---EPAGHPrSPes--------sS 387
gi 914910337  311 KLPADIPQDTEEQEARSRCASTKPGFQAEPCQKLADGMRLR--MEPPTIFMDLRPAespEPSDHQ-SSgs--------sS 379
gi 982966267  311 RVPADTPREARPWESGSRCASRELGFQA-----LAQDMQLKnpAEPPTIFTDLRPT---KTSDQE-PLes--------sS 373
gi 545815069  320 RAPADTPQD-KQQEAGSRCISRELGFQT-----LAENMRLRgpAEPPSIFIDLRPT---KPSDQG-SLds--------sS 381
gi 940737701  322 KVPADMRPDNEQLEARSRCALTKL-----------SQRRLRnpVEPPTVFIDLRPT---EPSDQG-ALestgsgsssssS 386
gi 149750958  331 KVPADTPQDTGQQEAGSRCASTELGSQAEVGPTLAAGTRLRstAEPPTIFMDLRPK---EPSDQG-SSes--------sS 398
gi 625207817  305 KISADKPRDTEEWEARSRSALVEPGFQTEPAQKLAGSRRLK--TEPPTVFIDLRQKepsEPQEHQes-----------sV 371
gi 1034113871 331 KVPADTPQDTKEADSGSRCASRKRGSQAGPGPQLAQGMRLN--AESPTIFIDLRQM---ELPDHL-SPes--------sS 396
gi 675705776  328 KMPANTPQDTEEAKARNRCASRKPGSQAVPGPQLAEPMRLN--TEPPTIFIDLRQT---EPPGRP-SPe----------- 390
gi 831227486  331 DVPADTLQDTKEQKAGSRCDSKKLGSQGEPGWKLAEGMRHN--MEPPTIFIDLRQM---EPAAHH-SPes--------sS 396
gi 511852615  315 ---ADRPQDTTQHEARSRSAAC---IQAELG--LAQSRQLRspAEPPTIFIDLRPS---EPSDPG-SVes--------sS 374
gi 73959246   329 KVPADAPQDTKPQEAGSRSAPMEPGFQAELGLTLAKGTHPRspAEPPTIFIDLRPS---EPSDVG-ALes--------pS 396
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755803764  389 SSSSDSEEE--EETAALGDQQGPAEQERHSSQGPRDHTGKSQLLQQLRAFRKGTAQPNLPATEGPGGQKAQVLEDTASSR 466
gi 291412087  388 HSSSDSEEEe-EETAALGDQQGPADRASPSSQGLRACTGKSQLLQQLRAFRKGAAQPGPPASDGCHGQKAQAPEDSAGSG 466
gi 914910337  380 HSSTDSEEDe-AERAALEAPHSPAQQAATLSQDFRSCTCKSQLLQQLRAFRKGTALPQEPARKGTGGQKA--LEDA---- 452
gi 982966267  374 SYSSSSDSEeaEETAAQRDLQGPARLR--------DCTGKSRLLQQLRASREASAWPQLPAGKSPVSQKAQAPGDPAGSS 445
gi 545815069  382 SSSSNSEEEeeEEAAAQRDPKGPMRL--------RDCTGKSQLLQQLRAFQKATAEPQLPAGKDPSNQKAQGPGDTAGSS 453
gi 940737701  387 SSSSDSEEAgeEETAARRDWQGP--------GGLRDCTGKSQLLQQLRAFRKGMAQPQWPANKVPRSQKA--PEDTAGSG 456
gi 149750958  399 SSSSDSEEEgeEETAVRREQQGP------SG--LRDCTGKSQLLQQLRAFRKGTAQPELPASKGPCSQKAQAPEDSAGSR 470
gi 625207817  372 YSSSDSEEE---DVEAADPVQGAVPRER------RDCTGKSQLLQQLRAFRKGGVASQLSTSDSPGGQKTQAPEDTAGLQ 442
gi 1034113871 397 HSSSDSEEEeeEEMAALGDAEGA----SPSSLGLRTCTGKSQLLQQLRAFQKGTAQPELPASKGPAGGRAQAPEDTAGSR 472
gi 675705776  391 -SSSDSEEEeeEEIAAMGDAEGA----SASSLELRTCTRKSQLLQQLRAFRNRTAQPELPASKGPGGGGPQVPEDAAGSG 465
gi 831227486  397 SSSSDNEEEe-EESAALGNQQDPAERASPSSQGLRNCTGKSQLLQQLRAFRKGTAQLQLPAGEGPGGQRAQTWADMATTG 475
gi 511852615  375 PSSFDSEEEe-EETVALRDQQGRPEQESPSPRQLWDCTGKSQLLQQLRAFRKETAQPNWPANGGPSGWKAQVPEDPASSA 453
gi 73959246   397 SSSSDSEEEe-EDTEALRDQRGPAERECPSSRGLRDCTRKSQLLQQLREFRKGTAQPNLPTAAGPGSQKAQIPEDPATSR 475
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|....*...
gi 755803764  467 TGRKQHVTHRAEKQSTQTRCCS---RALE-DPLGPGTAKEARVPPLGQ 510
gi 291412087  467 TGRKQHVKLWPEVQSAQATPPGgrpRALG-DPLGPGTAREALVPPLGQ 513
gi 914910337  453 TERKEQVKLSTEGKSTQTRLQGghpRALG-DPLEPESAREILVPPLGQ 499
gi 982966267  446 PGVKQHVTLWAE-RGTQARPAGgrpS----DS------------PGGL 476
gi 545815069  454 PVEKQHCTLWAERQSTQARHPEgslGALG-DPLGAGPAREDLVPALGQ 500
gi 940737701  457 AGRKQHVTL--------------------------------------- 465
gi 149750958  471 TGRKQHGTLQAERQRAQARPPGrspRALG-DPLGPGTARETLVPPLGQ 517
gi 625207817  443 TGRKKHIKLWAEKQNA---------LDLG-EPLGTQPARDMLLPAMGQ 480
gi 1034113871 473 TGRKQHMKLCAKGQSAQARLPRgrpRALG-DVPEPGAAREALMPPLEQ 519
gi 675705776  466 TWRKQHVKLCAEGQNAQAGLPGgrpRALG-DTLDPEAAREALVPPVDQ 512
gi 831227486  476 TGKKEHAKLWAEEQSTQAGLPRtspRALG-DVLGSGAAGEALVPPLDS 522
gi 511852615  454 TRRKQHVPAWAEPQNTQARCPGggpRALG-DALGPGTAREALVPPLSQ 500
gi 73959246   476 TKRKSHVPPWAEKQSTQATCPGgspRVLGdDALGPGTARETLVPPLGQ 523
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap