Conserved Protein Domain Family
DUF4702

?
pfam15774: DUF4702 
Domain of unknown function (DUF4702)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 346 and 637 amino acids in length.
Statistics
?
PSSM-Id: 318069
View PSSM: pfam15774
Aligned: 11 rows
Threshold Bit Score: 624.532
Threshold Setting Gi: 1040210941
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895301    18 HSTYVA----PLPKKHLLPEMRPTcklgRVPHLPSMNQ---YSEHQSHQQNFRHPLAFGGFLDFLTEGQVLDSLQTVVEQ 90
gi 1040210941  18 HSPYVAr--vQSLKKPPLPQMGSA----RVPPPRFTQG---TSAQPGPHRDTKGPQSFGSFLDFLTEGQVLESLQTVVEE 88
gi 884938945   18 HSTYKArvsvPPRKKPLLPEMRPAfklgHVPHPPAMDG---SSAYQGHCQTPKRPQPFGSFLDFLTEGQVMESLQTVVEE 94
gi 395858853   18 HSTYVAr--vPPPKKSVFLDMGPTfklgHEPHSPSTYA---SSVLRCHRQKRTAPQPFGSFLDFLTEGQVLESLQTVVEE 92
gi 914919707   18 HSTYIAr--vQPPKKPLLPEMGSAsklgRMPHPPSMDG---NSAYRGHRQTAKGPQAFGSFLDFLTEGQVLDSLQTVVEE 92
gi 586547250   18 HTTYLAr--vQPHKKPAFPEMGQAsklgHVPHPPSMYGpsgSSGLHSHRRNSKGPRPFGSFLDFLVEGQVLDSLQTVVEK 95
gi 545869889   18 pTTYVPr--vQPPKKPLFPERGPAskvgHMPHPPSMHSpvsSSGLRGHCRNLKGSRPFRNFLDFLVEGQVLDSLQTVVEV 95
gi 301781847   18 HTTYVAr--vSLPKKPLFPEMGQAsksgHMPHPPSRYTptdSLGLRGHRRNPRDPRPFGTFLDFLVESQVLDSLQTVVEE 95
gi 344295306   18 HTTYMAr--vQPPRKPLFPEMRPTsklgHEPHPPSLYGpsgSSVLRGHRRSAWGTQPFGSFLDFLVKGQVLDSLQTVVEE 95
gi 344253475    1 mtslSVq--mQLPKKHRLPGREPTfksgHVPHLPSMYR---YSEHQGQQQNLRPPQVFGTFLDFLTEGQVLDSLQTVVEK 75
gi 297708341   18 HSMCSAr--vQLPKKPLVPEMGPAckpgRVPHLPSTCG---SSALQGQRRNKRHPQPFGHFLDFLTESQVLDSLETVVEK 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895301    91 ATERLAAMKTEAGVPLVDIQDPVEVP-SSRHRSRARPSIDTVHRHRARPTLCAGRPNNYPSCSSSMSDSHSSITAGWLGS 169
gi 1040210941  89 ATERMATMKTGAGVPLVEVRDPVVEPaSGGRRPRARPTWSTVCRNRAQPSLCVGRPNNYPSRSSSVSDSRSSLTAGWLGS 168
gi 884938945   95 AAERIASMKTEAGVPLVEVQDFIEVP-SGKRQVRARPSFSTVKRHRIRPSLCTGRPNNYPSCSSSLSDSHSSLTAG---- 169
gi 395858853   93 AAERMAAMKTEAGLPLVEVQDPMEMP-SVRHRVHARPNLKTVRRHRAQPSLCVGRPNNYPSCSSSMSDSHSSLMAGCLDS 171
gi 914919707   93 ATERMAAMKTEAGVPLVEVQDPIEVP-S-GRRPRVRPSFSTVHRHRAQPSLCTGRPNNYPSCSSSMSDSHSSLTAGCLGS 170
gi 586547250   96 ATERMATMKTEAGVPLVEVQDPVEVP-RGGRRVRARPSLSTMHRHRVRPSLCIGNPNNYPSCSSSMSDSHSNFTAGWPGS 174
gi 545869889   96 ATERMATMKTGAGLPLVEIQDPVEVP-KVGRRACSRPSLSTVHRHRTRPSLCVGHPNNYPSCSSSMSDSHSSFRACWPGS 174
gi 301781847   96 ATERMTTMKTEAGVPLVEVQDPIEVP-RGGQRVRARPSLSTVHQHRARPSLCTGCPNNYPSSSSPMSDSHSSFTAGWLGS 174
gi 344295306   96 ATERVAAMKTEAGEPLVEVQDPMETY-SKGQRARARPSPSTVYRHRMRPSLCTGHLNNYPSCSSSGSDSRSSLSAGGLGL 174
gi 344253475   76 ATEHLAATKTEAGVPLVDIQDPLEAP-S-DRRTRAR---RTVHRHHARPTLCAGHPNNYPSCSSSMSDSHSSISAGWLGS 150
gi 297708341   93 ATERMAAMKTEAGVPLVEVQDPVEVP-SGGRRAHARPSLSTVHRHRVQPTLCTGHPNNYPSSSSSMSNCHSSLMAGYLGS 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895301   170 HSQDSDLGARGIGSLPPMRDKLLLEKNLKRLLRLENKGKILNQScSQRDSLLWDSLGSQTSSQWTREQPLSWFSGLLGSS 249
gi 1040210941 169 HGQGSDLGARGSGSLPPLKDRLLLEQSLKRLLKLERKGKSRSQP-SRKDSLRWDSLGSQTTSQWSPEQPLSWFSDLLSSS 247
gi 884938945  170 --QDGDLGPQGLGSLPPMRDKLLLEKNLKRLLQLENKGKGWSQScSKRNSLLLNSLGSQTGSHWTQEQPLSWFSGLLGST 247
gi 395858853  172 HSRDSDLGAHGLGPLPPMRDKLLLEKNLKRLLRLENKGKGLSQScSRRDSLPWDSLDSQTSSLGNREQPLSWFSGLLGSS 251
gi 914919707  171 HSWNSDLGAQGLGSVPPMRDKLLLEKNLKRLLRLEKKGKGLSQPsSKRDSLLWDSLGSQASSQRTREQPLSWFSGLLGSR 250
gi 586547250  175 HSRDSDMGYHGLGPLPPRRDKLLQEKSLKRLLRLENRGKSLGQSs-QRDSLLWDSMGSQSSSQWTPKQPLSWFSGLLGSS 253
gi 545869889  175 QCRDSALDAHSLGPLPAVKDRLLLEKSLKRLLQLENRGKGLGQCcSHRDSLPWDSLDSQASSQWTPETPLSWFSGLLGSS 254
gi 301781847  175 PSRHSDLGTQGMGSLPPMRDRLLLEKNLKRLLKLENRGKGLGQScFRRDSLLWDSLGSQASSQWTQEPPPSWFSGLLDSS 254
gi 344295306  175 RSHDNDLGAHGVGPLPPMRDRLLLERNLKRLLWLENKGKGQSKPsSQRDSLLWDSMGSQASSQWTPDQPPSWFSGLLGSG 254
gi 344253475  151 HNQDTAPGPRGIGSLPPMRDKLLLEKNLKRLLRLENKGKGLNHScPQRDSLPWDSLDSQTSSQWTREQPLSWFSGLLGSN 230
gi 297708341  172 HSRDSDLGAQGLGSLPPVRDKLLLEKNLKRLLQLERKGKGLSQScSQRDSLLWDSLGSQTSFQWTQEQPLSWFSGLLGSS 251
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895301   250 PATPETSELGLGEQEMIFLKQKLNKEMKSLLNQPRPFNLPTYCPLREPHHTLDFLAKHRLFPALQRVVSQAVDKLSHACR 329
gi 1040210941 248 TGTPEASGQTPSEEELSFLKQEFDKKLMALLSQPAALDLPGYCSLRQPHCTLDFLAQHHLFPALQSVVSQAVDKLSGARR 327
gi 884938945  248 SGMPDASELGPREQELIFLKGKCNKEKKSLLSQPTSFDLPGYCILREPHQTLDFLAKHHLFPALQSVISQGANKLRAARC 327
gi 395858853  252 SDIPEASDLGPGEQELIFLRREFNKELKSRLSQLSSFNLPGYCSLREPHHTLDFLAKHQLFPALQSVVSQAVDKLSGAYR 331
gi 914919707  251 PGTPEASEMGPGERELFFLKREFNKEMKSLLSQPASFDLPGYCSVRQPHCTLDFLAKHHLFPALQTVVSQAVDKLSCARR 330
gi 586547250  254 SGTPEVSDLGPTERELIFLKREFNKEIKSLLSQPTSFDLPGYCSLREPHRTLDFLAEHRLFPALQNVVNQAADKLSGARR 333
gi 545869889  255 SGTLEASELGPGEQELVFLKREFNKQIKSLLSQPVAFDLPGYCAIREPHRTLDFLAEHHLFPALQNVVSQAVDKLSGACR 334
gi 301781847  255 TGTPQTSEPRPGEQELTFLKREFDKEIKSLLSQPASFDLPGYCSFREPHQTLDFLAEHHLFPALQSVVCQAVDKLSGARR 334
gi 344295306  255 SGTPAASDLGPTERELIFLKREFNKEMKSLLSQPASFDLPPYCSAREPYHTLDFLAKHHLFPALQRVIHQAVDKLSGACR 334
gi 344253475  231 SATPET--LGLGEQEMIFLKEELTKEIKSLLNQPASFNLPVYCSLREPHRTLDFLAEHRLFPALQRVVSQAVDKLSHACR 308
gi 297708341  252 SGVPEASEPRPGEQEPIFRKREFNKEIKSLLSQLESLDLPGYCPLREPHRTLNFLADHRLFPALQSVVSQAVDKLRGARC 331
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895301   330 HNGFPLFPVTSETIPDLPGNSDLLQPSSKASIPTNRea-----rGEPCd-SL-TTAYSPKTSHRKS-------KGRRGSP 395
gi 1040210941 328 HDGCPLFPANAEASSELPLHYNLLPPGSQLASPTDK--------EEAA--SPnTTTSIPRTERRKS-------KGTRGSP 390
gi 884938945  328 RDGCPLFPT--KPASPFpvNYSQGLpDSK---PAEG--------KEPCd-SFhTTDASLHg------------KISRLNS 381
gi 395858853  332 RDGCPLFPANFQGTSELpsDFIEPPlAGRRSSPNSKlaetttdrEEPCn-SLhTTVSSPKMTSKKT-------KGKQVTP 403
gi 914919707  331 PDGCPLFPVNCDPNPAL--SFNLLPqDSRMVTPTRR--------REHYd-SFlSRASSSKITPRKN-------KGKRGSP 392
gi 586547250  334 QNGCPLFPSEWEPTTEP--NLEVMP-GSEGASLTEG--------EEPYsySLpTTTSSLKMVHRKSikskgggKPKEGGS 402
gi 545869889  335 RNGRPLFPSEWEPTTES---------NSKLATPTNG--------EEPDn-LLpTTASSPKVDHRKNvkprgrsKPKGGGS 396
gi 301781847  335 RDGYPLFPSEWEPATEP--NSDSTP-GSKPATPTDG--------EEPYd-VLpTQVSSSKMIRRKSakgrgraKPKEGGS 402
gi 344295306  335 PDGCPLFPMAYESTPEP--EPEPPP-GSMPSSPDEDpnd---geEEPYe-SLpTSVSSPKMGYRKSakgrgwgKVKEGGS 407
gi 344253475  309 HNGFPLFPVDSDPTPVMpgDYDLLQqNESKPNSRDG--------EEPSd-Sp-TTVSSPKTSRRKS-------KGRRDSP 371
gi 297708341  332 RNGRPLFPTSLEPTSELqvDGNLPPlGSEPATPTNG--------GQPQa-SPrPTVSSPKMLQRKR-------KDRGGSP 395
                         410
                  ....*....|....
gi 81895301   396 P-NAvqmATRFRLK 408
gi 1040210941 391 SmTS---ATRFKLK 401
gi 884938945  382 PsVSnqvGNRVKLK 395
gi 395858853  404 SvLSapvTTRFRFK 417
gi 914919707  393 PvSNaqvATKLRLK 406
gi 586547250  403 PmSStqgATRFRLQ 416
gi 545869889  397 PvSSiqvDTRFRLE 410
gi 301781847  403 PvSRaqvATRCRIK 416
gi 344295306  408 PvSGtqvATKFRLK 421
gi 344253475  372 SmSNaqmTTKFRLK 385
gi 297708341  396 SmSSaqvATRFKLK 409
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap