Conserved Protein Domain Family
SMG1

?
pfam15785: SMG1 
Serine/threonine-protein kinase smg-1
SMG1 is a family of eukaryotic proteins. In humans this family acts as an mRNA-surveillance protein. In C.elegans, SMG1, a phosphatidylinositol kinase-related protein kinase, is a key regulator of growth. Loss of SMG1 leads to hyperactive responses to injury and subsequent growth that continues out of control. It has an antagonistic role to mTOR signalling in these worms and possibly also in higher eukaryotes.
Statistics
?
PSSM-Id: 318080
View PSSM: pfam15785
Aligned: 12 rows
Threshold Bit Score: 751.577
Threshold Setting Gi: 328722472
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122121464   480 MYACQPSILKLLISNCRAQDLCLWARYPTTHQALLGLLVVHCQANHNFRTNSIL-----------FRDPGLS-TENTSPT 547
gi 768922858   615 MWALSPTVFTLLSQNLLLVHSDLAVYYPTIQYAVLYTLYSHCTRHDHFISSSLSss-------psLFDGAVI-STVTTAT 686
gi 1013891234  591 MYACKPSILELLLTNCRAHELKLWGRYPAAQQAIFSLLVVHCQANHNFRTNSSL-----------LRDQELS-AENTSPT 658
gi 195438928   603 MYACKPSILELLIRNCRADDLALWSRYPGTYEAILNLLATHCQANHNFRTTSSL-----------LRDGNIQnPEHTSPT 671
gi 762143055   614 MWALSPSIFDLASKHFSPLDEVVSEVYPAVQYALLNTLYSHCSRHGNFVSSSSLimq------ttRLDGSLM-ANVNPTT 686
gi 964099457   557 MYACKPSILELLLTNCRAQDLALWSRYPSTHQAIINLLVVHCQANHNFRTNSSL-----------LRDQEQPlSENTSPT 625
gi 328722472   600 MWALQPSIFELLSTKL---DPTIIKMNDPLRFSLMFLLYSHCKKHNNFVASSRLvta------grTSEKSQQnVEINSHK 670
gi 1032747237  747 MWALKPSILELLAVKLRPHDPLLSVESPLLQYHILFLLFTHCSRYNHFVPSSSLitgtsscrpldIFPGTLE-VPTVSPT 825
gi 751207851   734 MWALKPSILELVAVKLKPYDNTLSMASPFLQYNVLYLLYAHCSRYNHFVPSSSLitgttacrpmdMFPGTLD-VPATSPA 812
gi 765169727   460 MWALSPTVFALLTHNLTVVHSGLAVCYPAVQYAVLYSLYSHCTRHDHFISSSLSsss------psLFDGAVI-STVTTAT 532
gi 688542952   622 MWALSPTVFALLSQNLVIVHSDLAVHHPAVQYAVLYTLYSHCTRHDHFISSSLSsss------psLFDGAVI-STVTTAT 694
gi 971419732   551 MWALSPTVFALLSKNLMIVHGDIAVHFPAVQYAVLYTLYSHCSRHDHFISSSLSsss------psLFDGAVI-STVTTAT 623
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122121464   548 AHSFEYIIRFLDSILTKAgRLAAENLKLLLQWTQll---ltECRERAPlLLEQDGFLGICYSVGGAAAKWR---PLESAA 621
gi 768922858   687 KKHFSTLLGLLGGLLLKE-HLYIETRRLLLTWAQeisvlmkKSDTYSP-LFSLTTFNKFCRGLLANALNEDqsiCLQTCH 764
gi 1013891234  659 ANNFASILRFLDSVLGQAhQLTPQNLRVLLQWVEml---lrECREKSDlLMEQENFRGICCNIAATASKLT---PLESAA 732
gi 195438928   672 AQSFETIIGFLARNLEHSlQLTQQNLKLLLRWTHsl---ldECRERAStLLEQPDFMSICRSVAQIATKWG---LLEAAA 745
gi 762143055   687 ANNFTQILRLLAGLLSQV-HASYDSRCLGLKWIAdi----iGSLQTNPqIFYSEEFTNVIRYITQLGHNSDfqiSMSVCR 761
gi 964099457   626 ANNFATILRFLAAVLENAgLLNPQNLRQLLQWLQvl---lnECRDRCDlLLDQEQFLSICRSLVTTACKWS---PQESAA 699
gi 328722472   671 SGNLVKILNIFEKYLKR--NVNVDCKLLVLKWIYell-mhaDSASYLNiILLSPEMINIVRSLIYVALKRNeilLFDGIA 747
gi 1032747237  826 SGHLSIILNLIAKTIENK-RAPDQTLLLLLDWIQei---ylQAENYIGvLSKTEECQTVVSSLLVCGATTNhkvSMAVCK 901
gi 751207851   813 SGHLSIILNLIAKTYNK--NTPACTLLLLSTWLQei---cvQSEKYIGiLSETQECQSIISSLINCGATTNddvANAACN 887
gi 765169727   533 KKHFSTLLSLLGGLLSKE-HLQPEARRLLLTWAQeisllmvKSDTYSP-LFSLPSFHKFCRGLLDNALHEDngvSLHSCL 610
gi 688542952   695 KRHFSTLLNLLGMLLSKD-HLNPEARRLLLTWSLevalmmkKSETYAP-LFSLPSFLKFCKGLLANSLNEDttiCLQACN 772
gi 971419732   624 KKHFSIILNLLGLLLKKD-NLTQDTRKLLMTWALevavlmkKSETYAP-LFSLPSFHKFCKGLLANTLLEDvniCLQACS 701
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122121464   622 CMQAVLDFGPqalhtkQDLLVLYRDTALQQLQ-VLTTSGHAPYAQIYAQLPLHMTLFesglqg-----rrvcvwQQKMSQ 695
gi 768922858   765 CIMVLSSSLS------TELLQSCVDVCRVQLV-NSAVRVRQAYGKLLKTIPLDVALS-----------------VQSQPR 820
gi 1013891234  733 CIQTVLDYGLerlakyPQLLILYRDTALQQLQ-MVSTNCHAPYFQIYAQLPLHLTLTgceslmpgmtsrrvsvwQQRISQ 811
gi 195438928   746 CIQSVLGYGLts--qqDPLLLLYRDAALQQIKwILASNQLTVFAQIYAQLPLHVTLFaggvps-----priclwQQKISQ 818
gi 762143055   762 CLQDVYKINSnl---pINLIQSAVKLSVYKLS-DVRPEVRDGYLSLLRVLPANVTTRlysllhlggdndqsisvQEGAEG 837
gi 964099457   700 CIQIVLDYGPekqehlLELLTLYRDMALQQLQ-VLSPNGHTPFSQIYAKLPLRITLTggdtpipgmssrrvcvwQQRMSQ 778
gi 328722472   748 QILNIVLGNPtfcqskPLIVVDILDLCLSCIN-LTEHDISKQFYALIHKISLITVLQnvsicslknkskfnkkiNQMMSS 826
gi 1032747237  902 NIESLLKAKQvs--wsEEIYSNIVDLATLHLT-SLDKTVRETYGHLLMNIPLNIVIPklnkagllsddkkfrniQNYSCE 978
gi 751207851   888 LLEMLMTAKNvv--wkQETYSSIVDLATLHLT-SCNKTIREKYGALLMCMPINIVIPklnkqylfsdtkkvreiVIYSTE 964
gi 765169727   611 SLQLLLPWLS------SELLQRCVDVCRVQLV-HSTVRVRQAFAKLFRTIPLDVALS-----------------NHSVPE 666
gi 688542952   773 SLQVLSSSLT------MELLQRCVDVCRVQLV-HSAVRVRQAFGKLLRSVPMHVALS-----------------AHSHSE 828
gi 971419732   702 SLHALSSSLP------DDLLQRCVDVCRVQLV-HSGARVRQTFGKLLKSIPLDVVLS-----------------NRNHTE 757
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122121464   696 CSAV----------------RDNVFQQFVDHLQRPE---QEQLTQCLRELFVRSyqvapPDER-------QEKLSQCTRR 749
gi 768922858   821 MKDIslavrhhmsrapsstfHPQDFSDLISFILYGTl-hRGGKDPWLERLYYSCqrfekLDGRgcadsgkPGVVPQALLK 899
gi 1013891234  812 WSAV----------------RDTVFRDFFERVQKPE---QESLVHCLRELFVRScqvapQDER-------QMNLSQCTKR 865
gi 195438928   819 CSSV----------------RDTVFREFFEHLQQSE---QQQLNQSLRDLFVRScqisaMDER-------QEMLSHCIRR 872
gi 762143055   838 VTAAwlarrahinripngefHAVNFRQIMAYILHDTspiQSGSWNWLEAMFYSC-----QDAThdhkmieTFRMSNFVDN 912
gi 964099457   779 CSAV----------------RDSVFRDFFERLQHPE---QQPLTNSLRDLFVRScqvapQDER-------QEKLSQCTRR 832
gi 328722472   827 hmrrk----------avvtlKTEYFKNYMCEMIEPNtnnNDSTTHWLLDVVNSCsfdidSGET---------ELLSHAQH 887
gi 1032747237  979 --SLilaqrlhm-rsnngemQAQHFKTYMAFLLQEYyfdAFG----LSEVFTLCwptisDNET-------MAKMYELALA 1044
gi 751207851   965 --SLilaqrlhmrgnnngelLAQHFKTYMAFLLQEHyldASG----LSEMFTLCwpavpENGT-------TARMYDLALA 1031
gi 765169727   667 TRHIslaighlmsrahsttfHPQDFSDLISFILYGVl-hRGGKDPWLERLYHSCqrlerRDCRggsdssrLDLVPWALLK 745
gi 688542952   829 IKEIslairrhmskvpsntfHPQDFSDLIGFILYGTv-hRGGKEPWLERLYHSCqrlekKDSA---------MVPRALLK 898
gi 971419732   758 IQEIslairshmskapsntfHPQDFSDVISFILYGSt-hRTGKDNWLERLFYSCqrldkRDQP---------TIPRNLLK 827
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122121464   750 CQRLSAAWLQFEAARYCVDQRLRTTLGKPQETFLGFEAVIMRHARLLSGCAKEVERSSLD----GLSLEQLSAIQVNLGM 825
gi 768922858   900 NEAVLWQWAAWEAAQFTVLSKLRTPLGRAPDTFQTIEGMIRSLAAHAVNPEQDVGAWAGS----GGDGDGHHSNQLRLAL 975
gi 1013891234  866 CQRLATAWLQFEAARYCVEQRLRTTLGKPQDTFFGFEAIIMRHARLLSGCAKEMERSAMD----TLSLEELLNMQSNLSL 941
gi 195438928   873 CQRLAAAWMQFEAARYCVDQKLRTTLGKPQDTFLGFEAIIMRHARMLSGCAKEAERIDPD----GLSLMQLSNMQMNLNM 948
gi 762143055   913 NEAMLWFWATWESAQYCVLNRLRTPLGKPQETFTSIEGVLKMFAKELDKPAEERNDISKTdqkkGGAKSSDLSSHLRVHL 992
gi 964099457   833 CQRLATAWMQFEAARYCVDQRLRTTLGKPQETFLGFEAIIMRHARQLSGCGKEEERAALD----TLTLEELSNMQSNLVL 908
gi 328722472   888 CRVFLYFWINWEAANFCVINRLRTPFGKPNSTFRAIEGGIKMWARD--------SISALNdetkVKHTEGKLNNLRYTRN 959
gi 1032747237 1045 NRTFLFFWGGFEAAQHCVLNKLRTPLGKPQETFTTIEGALKTLAREISC-----TAEIPKkdkrG--LDYLLHEHTRVRQ 1117
gi 751207851  1032 NCSFLFFWSGFEAAQHCVLNKLRTSLGKPQDTFTSIESALKILAREISCHSNGVEKDVVRkerqG--LDRILHEHTRVRL 1109
gi 765169727   746 TEAVLWQWAVWEAAQFTVLSKLRTPLGRAQDTFQTIEGIIRNLAAYCLNPEQDLGAWAGS----GGDGDGHHSNQLRLTL 821
gi 688542952   899 TEAVLWQWAVWEAAQFTVLSKLRTPLGRAQDTFQTIEGMIRSLAAHSLNTEQELSQWSG-----GESDEGHHTNQLRLAL 973
gi 971419732   828 TDAVLWQWAVWEAAQFTVLSKLRTPLGRAQDTFQTIEGIIRSLAAHTLNPDQDVSQWTT-----ADNDEGHSSNQLRLVL 902
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122121464   826 LLGFLDALEKLIYNAAEGSAFALRPPEKPVAAFFRLNNPTCQSWFNRIRIGVVITAMHIQQPELVIRYAQQILV-----T 900
gi 768922858   976 LLQYLENLEKLMYNAYEGCANALTSPPKSIKTFFYTNRQTCQDWLTRIRLALMRVGLLSGKPAVTIRHGFDLLTef--kN 1053
gi 1013891234  942 LLGFLDVLEKLIYNAAEGSAFALRPPPKPVAAFFRLNNPTCQSWFNRIRIGVVIIAMHVQQPELVIRYAQQILV-----N 1016
gi 195438928   949 LLGFLDALEKLIYNAAEGTAFALRAPEKPVSAFFRLNNPTCQSWFNRIRIGVVIIAMHSQQPELVIRYAQQILV-----T 1023
gi 762143055   993 LLQFMEHLEKLLYNAYEGCAVSMPMSPKTVRTFFRTNKGTCLEWLSRVRSSVIKIALHSGMPAMAIRQCHQLLQem-kdN 1071
gi 964099457   909 MLGFLDALEKLIYNAAEGSAFALRPPEKPVAAFFRLNNPTCQSWFNRIRIGVVIIAVHVQQPELVIRYAQKILL-----T 983
gi 328722472   960 LVAFIECLEKSVCNAIDGTATALPTAQKPVRHFFHTNRNTCYEWNSTIRSAMLAVALNSGLSSSAIRHGQYLVHhl-tkQ 1038
gi 1032747237 1118 LVEFLEHLERVIHNAAEGCAVALLPHSKPVRTFFHTNRSTCKEWLNRIRLALCVVSLHAGLATNALRNGQRLLEdl-ctA 1196
gi 751207851  1110 LIEFLEHLERVIHNAADGCAMALLPLSKPVRTFFHTNKSTCKEWLNRIRLALCVVSLHSGLATSALRNGQRLLEdl-snA 1188
gi 765169727   822 LLQYLENLEKLMYNAYEGCANALTAPPKAIRTFFYTNRQTCQDWLTRIRLALMRVGLLSGQPAVTVRHGFDLLAef-rsS 900
gi 688542952   974 LLQFLENLEKLMYNAYEGCASALTAPPKGIRTFFYTNRQTCQDWLTRIRLALMRVGLLSGQPAVTVRHGFDLLTei--kN 1051
gi 971419732   903 LLQYLENLEKLMYNAYEGCANALTSPPKVIRTFFYTNRQTCQDWLTRIRLSIMRVGLLAGQPAVTVRHGFDLLTemktnN 982
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122121464   901 QKTQDATYSQALVYLAWAWISCQEADSLRGLYVWARAKSSsgKSYQWLQHAAEQAAGRREAALSGYQNVLAEEGQR-QEL 979
gi 768922858  1054 SSAQGPEVEVLLTLLAEALCELNCPEAIQGLAAWSLLTSG--RSLGWLSSVALQAEGRFEKAALEYQDHLSAVTGMdCSI 1131
gi 1013891234 1017 PQTQDPTYSQAIVYMAWALISCQESDSLRGLRLWASSKSS--KSYKWLKYAADQAAGKRESALAGYKTILAEKEQQ-SEL 1093
gi 195438928  1024 QNPQDCSFSQAIVYLAWAWICCQEADSLRGLYLWARCKVSg-KTFQWLHCAADQAAGRKETALSGYSQILAEDD---AEL 1099
gi 762143055  1072 NTLQGYDFEQTVLFLVKALVELKEGDAIMGVYNWCKEQTG--KKFLWIKALVEKATGKYESAAKELKNVLKVMVSSdSEK 1149
gi 964099457   984 QKAQDATYSQAIVYLAWAWVCCQESDSLRGLYLWARSKSS--KSFQWLQCAADQAGGRKDAALAGYRSLLNETEEQpPEL 1061
gi 328722472  1039 SEFPVKEFILAIIQLAWAYSKLKESDCIRGLYVWSKEVAH--LKLPFLNILADQASGKFEEAAESYMNLLTTnsdqiiiy 1116
gi 1032747237 1197 NNTQGAEFERATLCTARAMVMLGEAEALQGLYVYCKEK-D--RKFVWLKAAMEEAAGKYELAAENYRRILEDQILT---- 1269
gi 751207851  1189 DNTQGIEFERATLWTAQAMVALGEAEALQGLYVYTKNK-D--RQFSWLKAAMEEAAGRYESAVDAYKQMIDEHVRV---- 1261
gi 765169727   901 SS-QALELEVPLALMVEALCELRCPEAIQGLAAWSLQTCG--KSLGWVSSVALQAEGRFEKAALEYQDQLSAITGMdCSI 977
gi 688542952  1052 SSTQGPEMEVPVTMLVEALCELRCPEAIQGLAAWSLANTG--KSMGWLSSVALQAEGKFEKAALEYQEQLCAVTGMdCSI 1129
gi 971419732   983 SLSQGNELEVTIMMLVEALCELHCPEAIQGIAVWSSAVVG--KSLTWINSVAQQAEGRFEKATAEYQEHLCAMTGVdCCI 1060
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122121464   980 EPHTHQ----------------------------------------FVLAQMMQCLQDTGQWSQLVDLKQHKLLRPED-- 1017
gi 768922858  1132 KSSDCFlpkfsnstsspkhvnngd----nkktvllkgnecssevinFLVNKASQCYVALCDWASVKEWQTTVHTLKQNs- 1206
gi 1013891234 1094 EPHTRQ----------------------------------------FVVAQMMQCLQDLGQWSQLVELKQQHMMRPED-- 1131
gi 195438928  1100 EPHTRQ----------------------------------------FVIAQKMQCLQDLGRWSRLVELKQKHLNRPED-- 1137
gi 762143055  1150 ADSPRDdlskvemimpkkitgils----kqspfpppdsnipvlkvhFVVTEIFDCYEKLYDWESVMEWQENVLQYRQDys 1225
gi 964099457  1062 DTHTRQ----------------------------------------FVVAQMMQCLQDTGQWSQLVELKQRQLTRPED-- 1099
gi 328722472  1117 lkgggg--------------------------sinniegplevlqkFIIEQLKECYMSICDWKPLMDWSQNEENLIPSi- 1169
gi 1032747237 1270 --RSKDdskaleirck--------------------neggdsqvavFCMDHLCKCFRSVGDWKQLEAWKQREAEILDQ-- 1325
gi 751207851  1262 KATSDDecgggggsgsgr----------------sarlesdnqvlgFCMQRLSNCYKAVSDWSGLVEWKSRENEMLRQ-- 1323
gi 765169727   978 RTSPSCllklsssvsspkhsssge----srktvllksaecspevinFLANKACQCYMALCDWSSVKEWQATVNTLKQNs- 1052
gi 688542952  1130 KVFDRSllkltgtntsspkhtssge---grktvllkssecspevlnFLANKACECYVALSDWESVQEWQASMMNLKKN-- 1204
gi 971419732  1061 SGFDKTvlklansnsvnnaspkhslngetrktvltkpsdcspevinYLGNKACECYISIADWSAVQEWQNMVHDLKKS-- 1138
                          650       660       670
                   ....*....|....*....|....*....|.
gi 122121464  1018 KELNSFLQCRNVdv---sAFERLLARTESNS 1045
gi 768922858  1207 SISGSINLRTDL------NYIQALSRFEEGD 1231
gi 1013891234 1132 RELNPFLQRSNVev---nALERLLARGQEAC 1159
gi 195438928  1138 SELNPFLQRSNVev---sALEKLLAKSEELS 1165
gi 762143055  1226 HLQAAFNSDVDL------NYIRALSAFEDGD 1250
gi 964099457  1100 SERNPFLQQSNVev---sALERLLAKSEEQS 1127
gi 328722472  1170 AKDKYFWQNRYVs----aNDLQIVNDVEEGn 1196
gi 1032747237 1326 --DKNLCLRRQMleniapQQATCLRKFEEAE 1354
gi 751207851  1324 --DSHAVLRRQMmenivqQQADCLKKFEKGE 1352
gi 765169727  1053 TNPVSITLRTDL------NYIRALSCFEDGD 1077
gi 688542952  1205 SSSSSVNLKTDF------NYIRAMSRFEEGD 1229
gi 971419732  1139 TSNTSINLKADF------NYIKSLSSFESGE 1163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap