Conserved Protein Domain Family
EP400_N

?
pfam15790: EP400_N 
E1A-binding protein p400, N-terminal
EP400_N is a family of eukaryote proteins. the exact function of this domain is not known. This family is largely low-complexity residues.
Statistics
?
PSSM-Id: 318084
View PSSM: pfam15790
Aligned: 5 rows
Threshold Bit Score: 667.811
Threshold Setting Gi: 317373565
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373565    1 MHHGTGPQNVQHQLQRSRACPGSEGE-----------EQPAHPNP---PPSPAAPFAPSASPSAPQSPSYQIq-qLMNRS 65
gi 973203936    1 MHHGSGAQGVQRQLQRSKSFTGPEAE-----------EQQSQQQPgtlPQSPVTSFAPAASPSAPQSPNYQI---IMSRS 66
gi 971421723    1 MHHGNGPQNAQRQLQRSRSFTGSEGE-----------EQQAN--L---PQSPAASFAPSASPSAPQSPSYQIqqfIMSRS 64
gi 941817740    1 MHHGSGSQNIQRQLQKSKSVSGSEAEeqqqqpsmaatQQQATVSH---PQSPVTTFSSAASPSAPQSPNYQI---IMSRS 74
gi 765130903    1 MHHGSGSQNMQRQLQKSKSVSGSEeqqqp---slaatQQQ-TVAH---PQSPVTTFSSAASPSAPQSPNYQI---IMSRS 70
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373565   66 PATGQNVNITLQSVGPVVGGNQQITLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQ 145
gi 973203936   67 PVTGQNMNITLQNVGQMVAGSPQITLTTLPLQSPASPGFQHSAPQWRFEHGSPSYIQVTSPLPQQVQPQSPTQHSPVPLP 146
gi 971421723   65 PVAGQNVNITLQNVGPVASGNQQITLTPLPIPNPTSPSFQFSPQQRRFEHGSPSYIQVTSPLPQQVQSQSPTQPSPVPVQ 144
gi 941817740   75 PVTGQNVNITLQNVG--LAANQQITLTPLPIQNPASPGFQHSASQWRFEHAPSSYIQVTSPVPQPIQPQSPTQHSPVSLQ 152
gi 765130903   71 PVTGQNVNITLQNVGQMVTANQQITLTPLPIQNPASPGFQHTAPQWRFEHGPSSYIQVTSPVPQPIQPQSPTQHSPIPIQ 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373565  146 ALQnvRAGAPGPGLGLCSSSPTGgFVDASVLVRQISL-SPSSGGHFVFQDGSGLTQIAQG--AQVQLQHPGTPITVRERR 222
gi 973203936  147 GVQ--RSVAPAAGIGMCGQSPTR-FVDASMLVRPFSLsGSSNSGHFVYQDGTGLPQLASTtaGQVQLASPGAPGSVRERR 223
gi 971421723  145 TLPnvRAGTPGPGLGMCSQSPTRgFVDASVLVRQISL-SPSNGGHFVYQEGPGIAQIAQGaaAQVQLPSSGTPATVRERR 223
gi 941817740  153 GVT--RPGAPPTALGVRGQSPTR-FVEASMIVRQISLgSQAGGSHFVYQDGTALAQLAPPp-GQVQLASTGAPGSVRERR 228
gi 765130903  151 GVT--RPGAPSTALGVCGQSPTR-FVDAGMLVRQINLgSPSGGGHFVYQEGTGLAQIAPAttGQVQLTSPGTAGSVRERR 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373565  223 PSQPHTQSGGTIHHLGPQSPAAAgGAGLQPLASPSHITTANLPPQISSIIQGQLVqqqqvl-qgpplpRP--LGFERTPG 299
gi 973203936  224 LSQTHSQTGGTIHHLGPQSPAGS-GASSQTLGSPGHITTSNLPPQISSIIQGQLA-------------RPpaVFLEKSSQ 289
gi 971421723  224 LSQPHSQSGGTIHHLGPQSPVAS-GANMQSLTSPGHITTTSLPPQISNIIQGQLMqqqqqvlqgqqlsRP--IGYDRASG 300
gi 941817740  229 LSQTHSQTGGTIHHLGSQSPVAA-GTTLPTLGSPGHITTSSLPPQISNIIQGKLG-------------RP--IVFEKTAQ 292
gi 765130903  228 LSQPHSQTGGTIHHLGPQSPVAT-GSNLSALGNPGHITTSNLPPQISSIIQGQLA-------------RP--MIFEKTAQ 291
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373565  300 VLLPGAGGA--AGFGMTSPPPPTSPSRTAVPPGLSSLPLTSVGN--TGMKK-VPKKLEEIPPASPEMAQMRKQCLDYHYQ 374
gi 973203936  290 VVVAGVGGPa-ASFGISSALPPSSPSRANPPQGLPNPPLTPTGSs-GSVKK-PPKKLEEIAPATPEIAKLRKQCLEHHTK 366
gi 971421723  301 GLIAGVGGP--GAFGMTSPPPPTSPSRATVPQGLSSLPLTPTVN--TAVKK-QPKKLEEIPPANQETAQMRKQCLDHHHK 375
gi 941817740  293 GVVTGVGTPatATFSIPSSIPPSSPSLTSPPPGISSNPLTPTGMitASIKKqAPKKLEEIAPATPEIAQLRKQCLEHHTK 372
gi 765130903  292 GVVAGAASTatASFSIPSSIPPTSPSLSSPPQGVPSNPLTSTTMtaGTVKKqVAKKLEELAPSTPEIAQLRKQCLDHHTK 371
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373565  375 EMQALKEVFKEYLIELFFLQHFQGNMMDFLAFKKKHYAPLQAYLRQNDLDIEeEEEEEEEeeekSEVINDEVKVVTGKDG 454
gi 973203936  367 KMEGLKEVFKDYLIELFFLQHLQGNMMDFLAFKKKPCVPLYTYLRQNDLDLE-EEEEEEQ----SEVINDEVKVVTGKDG 441
gi 971421723  376 QMEILKETFKECLIELFFLQHLQGNMMDFLAFKKKHCVPLQAYLRQNDLDLEeEEEEEQ-----SEVINDEVKVVTGKDG 450
gi 941817740  373 KMESLKEVFKEYMVELFFLQHLQGNIMDYHAFKKKHCHPLNTYLRQNDLDLDdEDDEEEQ----SEVINDEVKVVTGKDG 448
gi 765130903  372 KMESLKEVFKEYLIELFFLQHLQGNMMDYLAFKKKPCVPLYTYLRQSDLDLEdEDEEEEQ----SEVINDEVKVVTGKDG 447
                         490       500       510       520       530
                  ....*....|....*....|....*....|....*....|....*....|.
gi 317373565  455 QTGTPVAIATQLPPKVSAAFSSQQQPFqQALAGSLVAGAGSTVETDLFKRQ 505
gi 973203936  442 QTGTPVAIATQLPPNVSAAFSVQHQQF-QAHQGTSTAGIANTVEIEALKRQ 491
gi 971421723  451 QTGTPVAIATQLPPNVSAAFSSQQQPFqQTHTGTPVTGTVNTIEMEAFKRQ 501
gi 941817740  449 QAVTPVAIATQLPPNVSAAFSTQQQ-F-QVHQGGASGSITNPGDMDAFKRQ 497
gi 765130903  448 QAVTPVAIATQLPPNVSAAFSTQQQ-F-QGHQGTASGTITNPGDMDAFKRQ 496
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap