Conserved Protein Domain Family
CCDC168_N

?
pfam15804: CCDC168_N 
Coiled-coil domain-containing protein 168
CCDC168_N is the N-terminal region of eukaryotic coiled-coil proteins 168 family. There are up to 17, on average 6, copies of this repeat in most members.
Statistics
?
PSSM-Id: 318098
View PSSM: pfam15804
Aligned: 11 rows
Threshold Bit Score: 104.891
Threshold Setting Gi: 514476197
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532062626  4939 THGEEDKENVLKKSIMYPKDISGKAKESLLDDILKIKKLQVNITQQNKQR--REGNEDINVLLNQTY-SFIASSPLFELD 5015
gi 296481638  3987 MQEEKDKANIFVRDPMHPKSLALKVRKSPLFRMLQAKKLQVSIKEQVKRE--QKGRRDTVVILSKIC-PFVTSSAHLQSD 4063
gi 1040230657 7123 TQVEEDKANISEKSIRHPKYRAVEAKKSPSSHMLEIKKRQV---------------QETVMSLSKRHfYFISSSTHLKLE 7187
gi 1039730514 4590 SYIEEDGVNIFERISMHPTAKHVNRKKSPLSCAPKIKRFKVDLEEQSKKK--HESSRGKVMLLRETC-SVITSSDVFKLD 4666
gi 444731114  6311 TQTEEDAANIFEKSKVFPKDTAVKGQKSPLSYTLQANKLWVNSKEQEEFG--QEVYAHTVVFPSKPR-PFAPSASS-ELY 6386
gi 444731114  6685 qKEEKETLKIDEKDKMLPKCTDLMAKKSSSLRILNTKELQWHIREQKRKRkmQEDKNELVTGQTNIH-TSLLTLPYLKFD 6763
gi 953877695  3222 vtQREDIANIFEKDIMHSKYVALKAKKSPLFHILNTNKLEVNIKEQVKGG--QEATKETVVLQSKIC-PLTTSSIPLKLD 3298
gi 281350382     2 TQREEDKTNTFEKDIMHPRYIALRAKKSPLSLVLKTKKLQVNIKEQVKAG--QEDNKETVVLLSKIH-PFLTSSTHLKWD 78
gi 545537937  4407 TQREEDKANNFEKDIIHPKYIGLKAKKSPLLLILKTKKLQVNMKEQEKVG--QEDSKETIVLLSKIH-PCVTS-THLKWN 4482
gi 514476197   517 tqrekkskkvenitlktvlqngqldtkqqeekpkkmkdeptvantsigipslhlkldtgtekacyimevtrgfllellqq 596
gi 820987610  3630 AKIQKDKASISEKSVMHPKHIAVKAEKSPLSHILKTKELQVNISQQGEKA--QEGEVETVVLLSKTC-PFVTSSAFLELD 3706
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532062626  5016 TIKEED-EPgKIKSYEPHPMLHVSFPSGQIRLTESISScaKKqshakpRKQCL------SQEE-GRIQPSATRG---LIG 5084
gi 296481638  4064 TIKEDKgGP-VLRHSVPHLKIQASRPSVQKAPLKSTDR--KK------EKQYP------PPTErDRAHAIVVRG---SVH 4125
gi 1040230657 7188 TIKEEDeESeLIQCDVLHPVSQELLLSGQMASTESTASqiKS------INQNL------PQKE-DRVQTVATSS---LMH 7251
gi 1039730514 4667 I--SEEvETeTMQSHVPYPVLQKPLPVGQVGSTKTIDNnfTK------RKLHP------PWEE-E-VQTSAIEN---LTY 4727
gi 444731114  6387 TITEEAdESePS-SSVPHHDFQEAQPLEKIASAESTNNhvKK------GKHEP------QEK--DRAQTVAKTA---FMH 6448
gi 444731114  6764 TTEGEGyVIrITKSPVPPLQFKESPDAGRTAYPETISGqlSN------DVKELkepileKEEK-DREKAVNTSS---IVG 6833
gi 953877695  3299 TIKEEEdESgVT-NYMPHLEPQNSLPLGQIASTESIDSrvKK------GKRHV------LQKEnDRGQTVAMNG---CTH 3362
gi 281350382    79 TIKDEEgEPgIIRNDAPHLELQESSTSGQTASTESPEShmKK------GEQHP------QQAEkNRVQTEAMSS---SMQ 143
gi 545537937  4483 AIKDKEgEPgIIRNDAPYIEPQESLPSMEIASTEVPDSyvKK------GEQRP------QQEErNRVQTEASSR---LLR 4547
gi 514476197   597 kssdtvqgvsrdstegnfttatqkvkeripqkeenkvkiltekvieeeedgegegekereEKE-DRAQTPDTDGwvcMVY 675
gi 820987610  3707 SIKEEEgEPgIARSFMLHLEIQESLPSGQTAPTKPTESlvKK------EKQLL------PQKE-DRVQAVSMHG---LMH 3770
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 532062626  5085 PSGTAFQAKTSASSHVVNICEHSALRNTQEPQGGIRGKAGLKQEKTRDPNVVQAEIWPSIPSPY 5148
gi 296481638  4126 ASGSNFKAKTSSPPHVFRVSKHDALSRRKEAQPSMEESAEQGRGRTGDPGVTPTKTRPSLPSPS 4189
gi 1040230657 7252 PDGVVFKAQTSAPPHVHGFTEQSPLSERKEPQWHTEEKVGQKQKGTADPEEAPTKTYLSTSSPA 7315
gi 1039730514 4728 LRGPIFMTKISAPPCVSSVKKHRTLSQ-KTHQWNSNEKTGQKQERTRHRNVVATKRDASIPllt 4790
gi 444731114  6449 PDGAVSKEKTLTPPCVLSITEHSPPSKRKEPQWSTEEQVGQKQDSTGDPDVVVAKTCpsmpsps 6512
gi 444731114  6834 PNDMYLKTKKSPVSH---------ICNSDDFQWKTEKKEEKVQKVEREPNVMPTEASTSISSLp 6888
gi 953877695  3363 PNGTDFKAKTSPPPCVFGVTEHDALSKRREPQCSSKERVELQQGRKGGPDVALTKTPPPMPSPS 3426
gi 281350382   144 PWGTDFKAKTSPPPYAFSVTELGALDKRKEPQWRMTEKGEQEQQRTRDPDVALTKTPPSTPSPS 207
gi 545537937  4548 --DTDLKAKTSSPPHTCSVTEHGDLNKRKEPQWSMKEE-EEEQQRTEDPDVALTKTPPSTPSPS 4608
gi 514476197   676 PKAALIGPKPSGTPYMLMTQEHSTLSRR-ESQWSIKGNAGESR-KEEQIRWGLTETHPSRREGR 737
gi 820987610  3771 PNGAVFKSKTSAPPQVFSITERSPLSKRKEPHWGMKERAGQKQDRTGRPHVILTKTHPFMPSLS 3834
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap