Conserved Protein Domain Family
DUF4707

?
pfam15806: DUF4707 
Domain of unknown function (DUF4707)
This family of proteins is found in eukaryotes. The function is not known.
Statistics
?
PSSM-Id: 318100
View PSSM: pfam15806
Aligned: 5 rows
Threshold Bit Score: 744.02
Threshold Setting Gi: 768923964
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 972956177 157 LDEPVVLSDEVIFPLTVSLDKLPVSTLKVKVIVTVWKQEVEKAEVQEHGYLTILQHRSPAHIFRDDLNTFKAQVSTTLTV 236
gi 768923964 141 LKAPLVLDDQLIFCLTVSLDKLPASTLKAKITATVWRQEVEDDDVKEHGYTTLLQLRSPTHIFRQDLSTFKTQVSTILNV 220
gi 908434581 150 akSAWVLEDQLIFCLTVSLDKLPVSTRKAKIVVTVWKQMEENAELRELGYLTLLQFRSPTCTFRQDLSTFKTQVSTTLDV 229
gi 410914694 175 LDEPVVLTDEVIFPLTVSLDKLPVNTLKVKVMVTVWKREAEKAEVQELGYLSVLQQCEPTHTFRHDLNTFKAQVSTTLTV 254
gi 556720893  83 VEEPIVSTDEVIFPLTVSLDRLPPGTPKAKIVVTVWKREVEAPEVRDQGYLRLLQTRSPGETFRGEQSAFKAQVSTLLTL 162
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 972956177 237 LPPPSVKCQQMTVSGKHLTMLKVLNASSQeEVCIRDVRILPNFNASYLPMMPDGSVLLVDNVCHQSGEVTMASFYRMDSL 316
gi 768923964 221 VAPPSVQCQQITVSGKHLILLKVLNCSSQ-EVCVRDTKIIPNYNSSFLPMMPDGSVLIVDNVCHKTAEVTMATFYRIKSE 299
gi 908434581 230 LPPPSVQCRQMTVSGKHLTVLKVMNCSSQdRMCVKDVKILPNYNSSYLPMMPDGSVLVVDNVCHQSAEITMASFCRIDNK 309
gi 410914694 255 LPPPTVHCKQMTVSGKHLAVLKVLSGSSQeEISIRDIRILPNLNASYLPMMPDGSVLLVDNVCHQSGEVGMASYCRVDSL 334
gi 556720893 163 LPPPVLKCRQFTVAGKHLTVLKVLNSSSQeEISVWDIRILPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGT 242
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 972956177 317 SCRLPSMLSALEEHNFLFQLQVNEQLQEDTKEGLEVPLVAVLQWSTPKLPFTNSIYTHYRLPSIRLDRPRFVMTASCESP 396
gi 768923964 300 ASPLPSVLSALEEQNFLFQLQLQDQGEEDSSVGMEIPLVAVIQWYAPTLPCTRYIRAFYVLPSICLDRPGLIMTASCSSV 379
gi 908434581 310 SSHLPCMLSALEEQTFMFQLQLQEKEEQQSSKGLEVPLLAVLQWHSPVHPAMRCISTCYSLPSVHLNRPELVMMASCPRT 389
gi 410914694 335 ASHLPTMLSTLEEQDFVFQLHLNEVPQDDSNEGLEVPLVAVLQWSTHKMPFTNCIYTHYRLPSIRLDRPRFVMTASCPST 414
gi 556720893 243 SGCFPCPLSALEEHNFLFQLRAGEQPPPGAKEGLEVPLIAVVQWSTPKLPFTQSIYTHYRLPSIRLDRPCFVMTASCESP 322
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 972956177 397 VRVRERFRVRYTLLNNLQDFLAVRLVWTPEGah---------sgRGQCAeecqsVSSVVCHTPLSNLGYCRKGSTLSFTV 467
gi 768923964 380 VRPLEQFRVKYTLRNNLEDFLAVHLIWNTEAqr---------grKQDPR-----MAVVVCQSPSNHLGWCRKGSMLSFTV 445
gi 908434581 390 VRPQQHFWVKYTLLNNLQDFLAVRLIWNSEGg-----------sQQDPS-----VGAVVCQSPLNNLGQCKKGSILSFTV 453
gi 410914694 415 VRVKEQFKVKYVLLNNLQDFLAVRLVWTPDSefhfmcvcvrrgqGEDSS-----LSAVICHAPLSNLGQCRKGSTLSFSV 489
gi 556720893 323 VRTYERFTVTYTLLNNLQDFLAVRLVWTPEHaqagkqlceeerrAMQAA-----LDSIVCHTPLNNLGFSRKGSALTFSV 397
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 972956177 468 AFQILRAGLFELSQHMKLKLQFTAS-VSNPPPDARPLSrkNSP--SSPAVRDILDRHqaSLGRSQSFSHQ--QPSRShlm 542
gi 768923964 446 VFQILRTGLFELSKNMKLKLQFNASpFSSPTAGVLPVR--NYPllSNSTIQGQQEMH--NLGRSHTFSHQneKPLYT--- 518
gi 908434581 454 AFQILKTGIFELSQHM----TFTAS-VPAPP---------TEP--QSP-LKNTFGGH--SLSRLKSFPHH--LPFWSvnl 512
gi 410914694 490 AFQILKPGLYELSQHMKLKLQFTAS-VSNPPPDARPLSrkNSP--SSPAVRDLLDRHqaSLGRSQSFSHQ--QPSRShim 564
gi 556720893 398 AFQALRTGLFELSQHMKLKLQFTAS-VSHPPPEARPLSrkSSP--SSPAVRDLVERHqaSLGRSQSFSHQ--QPSRShlm 472
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 972956177 543 RTGSVMERRAITPPVGSPIGRpl-yHPqDKAVLS----LDKIAKRECKVLVLESV 592
gi 768923964 519 RTSSEAAYPSIMSPGGAPENR----MP-EPQFTStaalLGKVAKRECKVLVLKTI 568
gi 908434581 513 RSGAVAELQTTTSPAGT-VNRaphlSP-DPSFVS----LVKIAKRECKVLVLE-- 559
gi 410914694 565 RTGSAMERRAITPPVGSPVGRplylPPqDKSLLS----LDKIAKRECKVLVVDPI 615
gi 556720893 473 RSGSVMERRAITPPVASPVGRplylPP-DKAVLS----LDKIAKRECKVLVVEPV 522
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap