Conserved Protein Domain Family
MREG

?
pfam15812: MREG 
Melanoregulin
Melanoregulin is a family of proteins found in eukaryotes. It is a putative membrane fusion regulator. MREG forms a complex with peripherin-2. It is required for lysosome maturation and plays a role in intracellular trafficking. It is a negative regulator of melanosome intercellular transfer and it regulates intercellular melanosome transfer through palmitoylation.
Statistics
?
PSSM-Id: 318106
View PSSM: pfam15812
Aligned: 12 rows
Threshold Bit Score: 206.82
Threshold Setting Gi: 637314654
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123885801  41 VIDDDERNLWSSPHDLSHTEAVDDRMLQSWIQTRNQLEKDSEEWQKLNYEIYTLRQARREVRARWRRILEDLGFQ--KEA 118
gi 82184679   44 KRRDQETNLWSEPGDPSHSERDDDRVLYKLLQCRQQTQPGSRGYRRLSIDIEAMRDVRREVRDKWKMILENLGFM--AEA 121
gi 557017249  40 VRWDEERNLWSTPHDSSHTEADDDRELYNLIVTRDQLDQDSEEWQKLNYDIHALRQCRREVRNRWRKILEDLGFQ--KEA 117
gi 573901108  43 RRRAEETNLWSEPADKSHTERDDDRELYNLLHRRAKTRRGSQGYRRLSVDIHAMRQVRRGVREKWKMILENLGFM--AEA 120
gi 556971388  40 RRRAEETNLWSEPHDKTHMERDDDRELYNLIHRRAKTRRGSEGYRRLSFDIHALRQVRRDVKDRWKMVLENLGFR--NEA 117
gi 512874007  39 RRRAEEANLWNEPQDVSHTERDDDRELYNLLQKRSKTRRGSEGYRRLSFDISAHRQIRKDVKDRWRVLLENLGFS--NEA 116
gi 973181725  38 TQRAEDWNLWSSPQDSSHTESDDDRELYNLLIMRNEVDKNTEVWEKLNYDIHTFRYIRREVKARWKKILLKLGFQ--KEV 115
gi 260836061   8 RLKDDDLNIWHDPQDRTHMETDEDLELYNLIRRRDECPRGSDEWSHLNFDIHTVRTRRREIRDRWVKILEMLGFDdlQEI 87
gi 637314654  38 KRKAEAENLWNEPVDSTHMERDDDRQLFTMLQKRSKLRRGSEGYRRLSIDIIAQRQIRQKVKDRWKHVLDALGFK--NEA 115
gi 768918559  43 KRRDEEANLWSTPGDPSHSEREDDRVLYSLLQARNKTRMGSSGYRRLSVDIEAMRDTRREVRDKWQTILENLGFM--AEA 120
gi 332209997  44 lVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKRILEDLGFQ--KEA 121
gi 874479856  21 lARDEEQNLWSTPHDVTHTEADDDRVLYNMIVGRSQLDKDSEEWQKLNYDIYTLRQTRKEVRSRWKHILEDLGFQ--KEA 98
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 123885801 119 ETLLSVTKQSTISNPKNMKRAMELLVKLSDNTTIF--PAGWDLPVRYLYIMDRLICLDAVDDFLNIAQKKYP 188
gi 82184679  122 ESLLNVSASASYDRMRNAASARSLLQTLHTETSLF--NSKEPPPERYLFILDRLIYLDAAEDFVAKARRFYP 191
gi 557017249 118 DSLLSVTKLSTVGNSQNLNQTRELLLKLAEETSIF--SNNGGLPERYLFVLDRLISLDAAEDFLKTASKRYP 187
gi 573901108 121 ESLLTVSSSTTYANLRYATTARSLLQALHQDTSIF--DSKGAPPERYLFVLDRLIYLDAAEDFVDKARRFYP 190
gi 556971388 118 ESLLTVTSNTPYNSMKNASEAKKLLETLAEETSIF--DDDSDPPDRYIFVLDRLIILDVAQDFLFKSRCYYP 187
gi 512874007 117 DSLLTVTSNTSYKSLRNPAEARHLLSLLAQESSIF--EQQSIPPERYLFVLDRLIVLDMGTEFVSIARRFYP 186
gi 973181725 116 DTLLSVNKQSTLSDSGNFTKAREYLSKLLEETSLF--PKGCEAQERYLIVMDRLVSLDSAEDFLKLAMKKYP 185
gi 260836061  88 DNILTVTAVTKETISQG---AKDLFNELSEESSIF--GVSSTKPARYLYVLERLIHIDLAQTFVETAKQLYP 154
gi 637314654 116 DGLLTVTSGTSYESLRKPQEARKLLNFLAEQTTIFgrNRGTGPPERYLFVLDRLLLLDIGDDFLSAARHFYP 187
gi 768918559 121 ESLLNVSAGASHDRMRNAPAARAMLNKLHSETSIF--SNKEPPPERYLFILDRLIYLDIADDFMAKAKRFYP 190
gi 332209997 122 DSLLSVTKLSTISDSKNTRKAREMLLKLAEETSIF--PTSWELSERYLFVVDRLIALDAAEEFFKLARRTYP 191
gi 874479856  99 DSLLSVTKLSIISDSQNMGKARDILLKLSEETNIF--PTSWQLSERYLFVVDRLIALDAADEFFKMASVVYP 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap