Conserved Protein Domain Family
FAM199X

?
pfam15814: FAM199X 
Protein family FAM199X
This family of proteins is found in eukaryotes. The function of FAM199X is not known.
Statistics
?
PSSM-Id: 318108
View PSSM: pfam15814
Aligned: 4 rows
Threshold Bit Score: 581.293
Threshold Setting Gi: 126342301
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82181946   56 RWNLTSCGTSVASSECSEELFSSVSVGDQDDCYSLLDDQELTSFDLFPEGSVCSDVSSSISTYWDWSDSEFEWQLPGSDI 135
gi 126342301  67 RWNLTSCGTSVASSECSEELFSSVSVGDQDDCYSLLDDQEFTSFDLFPEGSVCSDVSSSISTYWDWSDSEFEWQLPGSDI 146
gi 573890148  56 RWNLTSCGTSVASSECSEELFSSVSVGDQDDCYSLLDDQEFTSFDLFPEGSVCSDVSSSISTYWDWSDSEFEWQLPGSDI 135
gi 432880208  56 RWNLTSCGTSVASSECSEELFSSVSVGDQDDCYSLLDDQELTSLDLFPEGSVCSDVSSSISTYWDWSDSEFEWQLPGSDI 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82181946  136 ASGSDVLSDIIPSVPSSPCLVSKRKSKp--HRNLDELPWSAMTNDEQVEYIEYLSRKVSTEMGLREQLDIIKIIDPSAQI 213
gi 126342301 147 ASGSDVFSDVIPSIPSSPCLLPKKKNK---HRNLDELPWSAMTNDEQVEYIEYLSRKVSTEMGLREQLDIIKIIDPTAQI 223
gi 573890148 136 ASGSDVLSDIIPSIPSSPCLVPKRKSKp--HRNLDELAWSAMTNDEQVEYIEYLSRKVSTEMGLREQLDIIKIIDPCAQI 213
gi 432880208 136 ASGSDVLSDIIPSVPSSPCLFSKRKPKphpHRNLDELPWSAMSNDEQVEYIEYLSRKVSTEMGLREQLDIIKIIDPCAQI 215
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82181946  214 LPTDSEFIIELNCLTDEKLKQVRSYIREHSPRQRpnITRDNWKRSMASNGSTSGVSAHSSSNASMVSSTSSSTASTGSN- 292
gi 126342301 224 SPTDSEFIIELNCLTDEKLKQVRNYIKEHGPRQR--TTREPWKRSSYNCGSTSGVSGASSSSASMVSSASSTGSSVGNSa 301
gi 573890148 214 SPTDSEFIIELNCLTDEKLKQVRNYIKDHSSRLRpsSTRDSWKRSSYGSASTSGVSGASSSNASMVSTASSSNGSVGSSc 293
gi 432880208 216 SPTDSEFIIELNCLTDEKLKQVRNYIREHGPRQRasSTREGWKRSSHSSASTGGVSAVSSSNASMVSSASSSTGSTASNs 295
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82181946  293 ------------SSTNISRAHSDGNLA-TAAERIRDSKKRSKQRKMQQKALRKRQLKEQRQARKERLSGLFMNEEVLSLK 359
gi 126342301 302 s----------nSSANMSRAHSDSNLStSAAERIRDSKKRSKQRKLQQKAFRKRQLKEQRQARKERLSGLFLNEEVLSLK 371
gi 573890148 294 ------------SAANMSRAHSDSSLSaSAAERIRDSKKRSKQRKLQQKALRKRQLKEQRQARKERLSGLFLNEEVLSLK 361
gi 432880208 296 vaggpasacsggSAANISRAHSDGNLS-SAAERIRDSKKRSKQRKLQQKALRKRQLKEQRQARKERLSGLFLNEEVLSLR 374
                        330
                 ....*....|....*
gi 82181946  360 VTEEEDHCDdVDVLM 374
gi 126342301 372 VTEEDHEGD-VDVLM 385
gi 573890148 362 VTEEDNEGD-VDILM 375
gi 432880208 375 VTEEDDHADvLDILM 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap