Conserved Protein Domain Family
DUF4711

?
pfam15829: DUF4711 
Domain of unknown function (DUF4711)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 130 and 288 amino acids in length.
Statistics
?
PSSM-Id: 318121
View PSSM: pfam15829
Aligned: 12 rows
Threshold Bit Score: 280.9
Threshold Setting Gi: 50758392
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158513735   1 MDTILVFSLIITSYNVTKKELRDSSCQVEPLPDLFPKDVRSIRAELIR---EAQAEAKRPMFIQNQTVAILQCLGSGSKV 77
gi 158563923   1 MDTILVFSLMIASYDSNKNDLRKSSCQVEQWPSFFSEDVRSNKDLVVRvplEIHTDTKGTPFIQNQPIATLRCLGSGRRV 80
gi 611990948   1 MDTILFFSLIFASYDANQKELEGSSCQVEQLPGLFPRDMRSIRVLLIQ---EAQGEAKRQAPGHNQIVANLQCLGSGRKV 77
gi 821480895   1 MDTILFFSLIFVGHDVSQKELKGSSYHTEQFPELFPRNMRNTKVLLLQ---EAQGGAQREALGQNQMVATLQCCGSGSQV 77
gi 345805709   1 MDTILVFSLIIMSYDVSKKELRDSNCHVEQLPRLFPKDVRRIRDVLMQ---EAQAEAKRSTFIQNQTVATLQCLGSRSKV 77
gi 859776297   1 MDTILVFSLIITSYDVSKKGLRDSSCHVEQLPGFFPKDARRTGDVLTQ---EAQAQAKMSTFIQNQTVATLQCFGSGSKV 77
gi 545180621   1 MDTILVFSSIITSYDANKKELRPNSIKqq-lPSLFPKNVRRIRDALMQ---QVQAEAKRSKFIQNQTVATLHCLGSGSKV 76
gi 50758392    1 MVTLLILSLVIVHRSLIREDLRDYRCHVGSA--WAAGRTRNLDVFLQA----PGIAETRGTLSRNHKVTFLECFSHQSSV 74
gi 444720991   1 MDTILVFSLIVTSYDANRKALRDSSCQVEQLPGLFPKDVRSIRDLLMK---ETHTEAKRATFTQNWTVATLQCLGSESKV 77
gi 984118350   7 MDTILVFSLIIVSYDSNKKDLRESSCQVEQFPGLFPKDVKSMREFLMQ---ETHTEAKRATFIQNQTMATLQCLGSGSKV 83
gi 344285731   1 MDTILVFSLIIISYDVNKKEISESSCQVELLPELFPKDVRNIRDMLIQ---EAQAEAKRATIIQNQTLATLQC--SGSKV 75
gi 940741702   1 MDTILVFSLIITSYDANKKELRDSHCQVEQLPGLFSMGMRSTRDVLMP---EAQAEDNRSTFVQILTVATLQCLASGSKV 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158513735  78 KVNLVHSE-------KRQKVKHILKNLRVMTVPCRNSTAPPSCHLT--PASKVQAGFLVTgkAFLPGVSQCKVYPV--MG 146
gi 158563923  81 TVHLVYSE-------RRPKVKYIMKNLPVITDLPRNSTASPRCHLR--ATSQFQNGSLLT--AFLPGISQCTVYSAkdRS 149
gi 611990948  78 IVNLQDSE-------KRPKTRYTLKSLSVMTAPPQDSPSRLRCYLStaPKMWFQGGRHFTiqVFLPNISNCKFYPV--VE 148
gi 821480895  78 TVNLQDWE-------KRPKAWYSLQSLSVMTAPLRDSLPGPRCCLStvPQLWSPTGLHVTvqVFLPNISNCKFGPM--VE 148
gi 345805709  78 KVNLVYSE-------KRSKTKHTLKNLRITAAPSRNSTDSPNCHLT--PTSKFQTGFLLTgkAFLPGISQCKVYAV--RK 146
gi 859776297  78 KVNLVYSE-------KGSKVKQTLKNLRVIAVPRRYSTASPKCHLT--STTKFQTGSLLTgqAFLPGISRCKVYVV--MR 146
gi 545180621  77 KVNLVYLE-------KRSKVKHTLKNLRVTAAPYRNSTASLSCHLT--LTSKFQTGSLLTgkAFLPGIFQCKVYLV--MG 145
gi 50758392   75 QVNLLHLEkmhgdltEWVAEECTVESLQVI--PSTAGTPNHTCVLRtsTRRHFHRRFIFRskVFLAVISNHTVTATppKQ 152
gi 444720991  78 KVNLVYSE-------KKPKVKHILKNLRVITAPHGNSSSSPRCRLT--LTAKFQTGSMLKgqAVLPGISQCKVYPV--ME 146
gi 984118350  84 KVNLLYLE-------GRPEVKPVLKNLRVIDAPHRNSSASPSCHLI--PTSKFQTGSILTgkAFLPGISQCKLYPM--MR 152
gi 344285731  76 KVSLMYSE-------KKRNIKYTLKNLRVIAAPSRNSSASPSCHLA--PTFKSQTGSLLAgkAFLPGISQCKVYPV--TV 144
gi 940741702  78 KVSLEYSE-------KRPKVKHTLKNLRVIAAPHRNSTAFPSCHLT--STSNFQNGSLLTgkAFLPGIFQCKVYPA--MR 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158513735 147 ASSETYPSTTTSVTPG-KkGEKTTKVDGFSsplnqdTDENLEKRKK-------WSIVVKVLIAVTLFVSGIAITVFVIFE 218
gi 158563923 150 ASSEMVPITTSSTTPRsK-GDEATSTGAFPnpltqgIDMSLKRRQK-------WSLVVKALIAVTLLLGGAAIIVFVIFE 221
gi 611990948 149 DSSEGLTATSIITTAPeDkEERPTITD---------PDEDLLMRQK-------WSIVVKALIAITLLISGVAITVFVIFE 212
gi 821480895 149 APLERLSTTTIITPITeDrEEEESSITDIG--------EDLLLRKR-------WSIVVKALIAVTLLISGMVIIIFVIFE 213
gi 345805709 147 AASETFPTTTTSITPGeKgGEKTTSTDDFSstxkqdTDENLKKRQK-------WSIVVKFLIAVTLLLSGVTIIVFVIFE 219
gi 859776297 147 AALETFSTTVPSISPGnTeGEKTTSTDDFSsplkedTDENLKKRQK-------WSIVAKFLIAITLLLSGVAIIVFVIFE 219
gi 545180621 146 ALLQTFPTITTSMTPGsKeGEKTTSTDFSSp---------FKQQDEnleerqkXSTVIKFLIAVTLLLSRVTITIFVIFE 216
gi 50758392  153 KAFSNGSSTPHVRSEQqTsQEKIPSANG----------KDSLVRQN-------ISIFMKAFIVCILLAPMICYTIFFIHE 215
gi 444720991 147 ASLETFSTTNTSIAPRtTkGEKTTSIE---------TDENLEKRRK-------WSIVVKSLIAVTLLLSGVAITVFVIFE 210
gi 984118350 153 TSLETFPITTTSTTSGnKeEEKTTSTSDFSspltqvTDEDLAKRQK-------WSIVVKFLIAVTLLVTGVAIMIFVIFE 225
gi 344285731 145 ASSETFSIIIVSITPGnKeRARTTSIDE---------DDGLAKRQK-------WSIVVKFLIAATLLLSGIAIIVFVIFE 208
gi 940741702 147 TSLKAFPTTTTSITPGnKeGEKTTSLd---------TDENLEKRQK-------WSIVVKFLIAGTLLFSGIAITVFVIFE 210

                 ....*
gi 158513735 219 VPCPS 223
gi 158563923 222 VPCPS 226
gi 611990948 213 VPCPS 217
gi 821480895 214 VPCsr 218
gi 345805709 220 VPCLs 224
gi 859776297 220 VPCPS 224
gi 545180621 217 VPCPv 221
gi 50758392  216 ISHLC 220
gi 444720991 211 VPCPS 215
gi 984118350 226 VPCPS 230
gi 344285731 209 VPCPS 213
gi 940741702 211 VPCPC 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap