Conserved Protein Domain Family
DUF4712

?
pfam15830: DUF4712 
Domain of unknown function (DUF4712)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 133 and 267 amino acids in length.
Statistics
?
PSSM-Id: 318122
View PSSM: pfam15830
Aligned: 7 rows
Threshold Bit Score: 291.5
Threshold Setting Gi: 637270720
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905753    1 MSEKLRRCRKELTAAIDRAFEGVRHSQECTAQQRLD---APSLTSQPVHRLLC-RNPL--AACPSAA-----------PY 63
gi 74738329   13 MSEKLRRCRKELTAAIDRAFEGVSYSQECTGQQRLElsaAPLSFSLPVHRLLCrRHPL--AACSSAA-----------PF 79
gi 568962743   7 MSEKLRRCRKELTAAIDRAFEGVRHSQECTAQQRLD---APSLTSQPVHRLLC-RNPL--AACPSAA-----------PY 69
gi 637270720   9 MSEKLNRCRKELAAAIGRAMEDLS----------IPplaSPDSAADLSSDLPTtRTPTppNEEPSSQkgestpptvycPQ 78
gi 562887243   1 MSEKLRRCRKELTAAIDRAFEGASHSQEGPGPRR------PPALAPPLHRLLCrRHPL--AAC---------------AL 57
gi 803186258  23 MSEKLRRCRKELTAAIDRAFEGVSHSQECSGRPRVEpdaAPLSFPLPVHRLLCrRHPL--VACSSAA-----------PF 89
gi 989920937  15 MSEKLRRCRKELTAAIDRAFEGVSHSPECPGRQRLEmdsAPLSFPVAVPGLPCrRHP----ACPSAA-----------PL 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905753   64 SGaSCAP--ESENPAFRTHHIPVNSKlqQ-PLYPKRKPLTSKENVLMQSSILARDRQFWRAAGDGEDWRKDSLRKDMERD 140
gi 74738329   80 AAvPCAP--ENENPAFATNHAPVNAKp-H-ALCPERKPLTSKENVLMHSSILAPERESWRTAGEGENWRKENLRKDMERD 155
gi 568962743  70 SGaSCAP--ESENPAFGTHHIPVNSKl-QqPLYPKRKPLTSKENVLMQSSILARDRQFWRAAGDGEDWRKDSLRKDMERD 146
gi 637270720  79 VSlPVAStsEKENPLFRQNLIPVTVAp-N-IQSPKREPLSSKENTWLHPQIFIADRQFFLSLEDSER-RKQHLSKTDERP 155
gi 562887243  58 ATaPCAP--ENDNPAFAPIHVPASTKp-Q-ALCTQRKPLSSKENVLAHSSLLGPERQFRKAAGAGEGWRKECLRRDLERD 133
gi 803186258  90 SPiPGAL--ENENVAFAPNHAPVNAKp-Q-VLCPKRNPLSSKENILVRSSILAPERQFWRAAGDGENWKKDSLRNDTEKD 165
gi 989920937  80 APvPCAL--ESEGPAFAPNQTPVSAKp-Q-ALCPQRKPLTSKENVLLHPSILAPERQFWRAAGDGENWRKDGLRKDTEKD 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905753  141 LKADPNVLLSSSSQEVTKDLLDMIDHTSIRTIEELAGKLEFENELNRVCGHCQDSPFKEEAWALL-VD-ESPQKALD-AD 217
gi 74738329  156 LKADSNMPLNNSSQEVTKDLLDMIDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALL-MD-KSPQKATD-AD 232
gi 568962743 147 LKADPNVLLSSSSQEVTKDLLDMIDHTSIRTIEELAGKLEFENELNRVCGHCQDSPFKEEAWALL-VD-ESPQKALD-AD 223
gi 637270720 156 MKSETSVSDDDAAPQNLKELADLSDNPAMWPAEKLPRKPGFENELQEV-SRLSSELFPLDASSVLdMDvSSFRKVLE--- 231
gi 562887243 134 LKVDSNMPLSSSSQEVTKDLLDMIDHTSIRTIEELAGKLEFENELNHVCGHCQDSPFKEEAWALL-GD-ESPQKASD-AN 210
gi 803186258 166 VKVDTSIPLSGSSQEVTKDLLDMIDHTSIRTIEELAGKLEFENELNRVCGHCEDSPFKDEAWALL-VD-ESPQKAPD-TD 242
gi 989920937 156 LKVDSNMPLSSSSQEVTKDLLDMIDHTSIRTIEELAGKLEFENELNRVCGRGEDSPFRDGAWALL-LD-ESPQKASDaAD 233
                        250       260       270
                 ....*....|....*....|....*....|
gi 81905753  218 PGSLKQALDDQNIVETVLDLEEDYNLMTSF 247
gi 74738329  233 PGSLKQAFDDHNIVETVLDLEEDYNVMTSF 262
gi 568962743 224 PGSLKQALDDQNIVETVLDLEEDYNLMTSF 253
gi 637270720 232 -----HSTEDEAIIETLLDMEEEYRLNSST 256
gi 562887243 211 PGGLKQAFDEHNIIETVLDLEEDYSLMTSF 240
gi 803186258 243 SGGLRQAFDDRNIVETVLDLEEDYNLMTSF 272
gi 989920937 234 PGGLRRAFDDRSVIETVLDLEEDYNLMTSF 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap