Conserved Protein Domain Family
DUF4714

?
pfam15833: DUF4714 
Domain of unknown function (DUF4714)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 143 and 164 amino acids in length.
Statistics
?
PSSM-Id: 318125
View PSSM: pfam15833
Aligned: 4 rows
Threshold Bit Score: 200.149
Threshold Setting Gi: 821470006
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332816867  14 PEETQEDSVAPmmpSQRSRGPLAPNHVHEVCLHQVESISDLHSGaGTLRPYLTEE--ARPWDELLGVLPPSLCAQAGCSP 91
gi 927199752  47 PEGTQEDTAAP---TTRNRAPVAPNHVQEVRLYRVESISDLHSG-GPLCPYLAEE--AQPWDELLGILPPSLCAQTGCSP 120
gi 821470006   2 PGEAREDAILPimvSP-STGTIPPSHLTEVSLHPVESISDLHNG-ASLHPHLSDDptSQQWEELLGVLPPSLCVQAGCNP 79
gi 859823812   2 PEETQEADTVAltaSSRSREPLAPSHTQEVRLHQVESISDLHSG-GSLRPYLAEE--AQPWDELLGILPPSLCAQAGCGP 78
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 332816867  92 VYRRGGFLLLLALLVLTCLALALLAVYLSVLQSESLRILAHTLRTQEETLLKLRLASLSQLRRLNSSEAQA 162
gi 927199752 121 VHSRGGFLLLLALLVLTCLALAVLAVYLSVLQSESLRALVHTLRAQEEVLLKLRLASLSQLRRLNFSETRA 191
gi 821470006  80 AHGRGAFLLLLALLILTCLALAILAVYLSVLQSESLRVLAHTLQVQEETLLKLRLASLNXwRRLNGSDARG 150
gi 859823812  79 LQGRGSFLMLMALLVLTCLALAILAVYLSVLQSESLRVLAHTLHTQEETLLRLRLASLSQLRRLNSSEA-P 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap