Conserved Protein Domain Family
DUF4715

?
pfam15835: DUF4715 
Domain of unknown function (DUF4715)
This family of proteins is found in eukaryotes. Proteins in this family are approximately 150 amino acids in length. The proteins are described as coiled-coil domain-containing protein ENSP00000299415-like.
Statistics
?
PSSM-Id: 318127
View PSSM: pfam15835
Aligned: 2 rows
Threshold Bit Score: 254.265
Threshold Setting Gi: 543173101
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 543173101   1 MEPLYQAGSILMTVNTLQGKKMIESGLQSGDFSLSQSWPSCLPPPADLEILQQKVAGVQRELEDFKKEALKSIHYLEDAF 80
gi 675742733   1 MEPLYQAGSILMTVNTLQGKKMVESGLQSGDFSLSQSWPSCLPPPADLEILQQKVAGVQRELEDFKKEALKSIHYLEDAF 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 543173101  81 CEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLREHCKRLEDLLLDR 139
gi 675742733  81 CEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLREHCKRLEDLLLDR 139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap