Conserved Protein Domain Family
DUF4716

?
pfam15837: DUF4716 
Domain of unknown function (DUF4716)
This domain family is found in eukaryotes, and is approximately 60 amino acids in length.
Statistics
?
PSSM-Id: 318129
View PSSM: pfam15837
Aligned: 2 rows
Threshold Bit Score: 117.121
Threshold Setting Gi: 795206487
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 148701258  50 SFRYTVVLISSMEPCSSTACAWSFWPSITERRDTEAWGLGTGLRREMEKAASEGLIKSVV 109
gi 795206487 123 SWGALSSTQCSTEPCSSTACPWSFWPSSTGRRTTEAWGVGTGLRRLNEKAASGVLIKLLF 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap