Conserved Protein Domain Family
DUF4717

?
pfam15838: DUF4717 
Domain of unknown function (DUF4717)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 103 and 139 amino acids in length. There are two conserved sequence motifs: LLLL and CFNLAS.
Statistics
?
PSSM-Id: 318130
View PSSM: pfam15838
Aligned: 14 rows
Threshold Bit Score: 102.948
Threshold Setting Gi: 81905822
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 81905822   37 LDGDKSQKDKVSSEDQGEEEYEEHFEASSEGEQWQEIDMVQQE-DTISQAITLQDHLLDLAFCFNLASIMFF 107
gi 71152393   31 GPKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEeDQSSKTAAVHKHSFHLSFCFSLASVMVF 102
gi 831228765  32 SPGSEEREEETPSPDQNQEQFEEHFMISSVGEMWQVMDMAQQEeDKTSETAALHDHLFYLAFCFNLASIMIF 103
gi 755704289  38 DPNERSQNEKTPSTDQDQENFEEHFVASSVGEMWQVVDMAQQEdDGTSDRAALRDHLFNLAFCFNLASIMVF 109
gi 562831320  33 GPDERSQNEKTPSTDQDQEQFEEHFMASSVGEMWQVMDMVQQEeDTTSKAATVHDHLLDLAFCLNLASIVVF 104
gi 664758370  20 SPDERSQKEKTASTDQVQEQFEEHFVASSVGEMWQLVDMAQQEeDMTSETAAVHDHLFDLAFCFNLASIIVF 91
gi 157820719  35 LDGDKSPKEKMSSKDQGEQQYEEHFVASSVGELWQVVDMAQQE-DTNSKASAIRDHLFDLAFCFNLASIVFF 105
gi 344237880  13 LDDGRSQKEKVFSVDEGKEQFEEHFMASSVGELWQVIDMAQQEeDTFAQAATFRDHLFDLAFCFNLASIMVF 84
gi 532081824  34 DMDEGKQKEKMASADQNQEQFEEHFLASSVGELWQVMDMAQQEeNTTSKAAAVRDHLFDLAFCFNMASIMFF 105
gi 655815583  34 DPDGKNQEEQISSEDQNQEMYEERFVASSVGELWQVVDMAQQEeDMTSESAVIRDHLFDLAFCFNLASIMVF 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap