Conserved Protein Domain Family
DUF4720

?
pfam15846: DUF4720 
Domain of unknown function (DUF4720)
This family of proteins is found in vertebrates. Proteins in this family are typically between 101 and 117 amino acids in length.
Statistics
?
PSSM-Id: 318134
View PSSM: pfam15846
Aligned: 5 rows
Threshold Bit Score: 149.251
Threshold Setting Gi: 861497009
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 861497009  20 PGRVLGATLRKDDSWKPLSNPRNRNLFFRTLQAYFKGRGLDLGKFPSNFSI-SDNRRPLSVQLENITSAFADYEEQRKTS 98
gi 332209650  33 LGHVNGATLRNEDKWKPLNNPRNRDLFFRSLQAYFKGRGLDLGTFPNPFPT-NENPRPLSFQSELIASASADYEEQKNSF 111
gi 612020244  22 VRQGQGAPLRGEEKWKSLDNPRNRDLFFRTLQAYFLRRGLDLEKFPNAFYInNEKPWPSSFHSDPMASAFADYEEQKNSF 101
gi 733894353  16 RGLAKGAPFEPEEKWKPLDNPRNRDLFFRTLQAYFLGRGLDLRNFPATFTVnNEGPRPVIFYSDPIASAFADYEERKNSF 95
gi 927210802  54 PGLVHGAMLRNEEKWKPLNNPRNRDLFFRTLQAYFKGRGLDLERFSNTFSM-NENPRPLSFQSELIASAFSDFKEQKNSF 132

                 .
gi 861497009  99 S 99
gi 332209650 112 H 112
gi 612020244 102 S 102
gi 733894353  96 P 96
gi 927210802 133 P 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap