Conserved Protein Domain Family
DUF4726

?
pfam15855: DUF4726 
Domain of unknown function (DUF4726)
This family of proteins is found in vertebrates. Proteins in this family are typically between 40 and 110 amino acids in length.
Statistics
?
PSSM-Id: 318139
View PSSM: pfam15855
Aligned: 3 rows
Threshold Bit Score: 131.096
Threshold Setting Gi: 259585570
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259016192  10 SRGEAAGVDRGKAGLGLGGRPPPQPPREERAQQLLDAVEQRQRQLLDTIAACEEMLRQLGRRRPEPAGGGNVSAKPGAPP 89
gi 259585570  10 SRGEAAGVDRGKAGLGLGGRPPPQPPRDERAQQLLDAVEQRQRQLLDTIAACEEMLRQLGRRRPEPAGGGNGSAKSGAPP 89
gi 940758345  18 SGREAAGVDRGKAGLGLGGRPPPQPSRDERAQQLLDAVEQRQRQLLDTIAACEEMLRQLGRRRPEPAGGGNVSSKPGAPP 97
                         90       100
                 ....*....|....*....|.
gi 259016192  90 QPAVSARGGFPKDAGDGAAEP 110
gi 259585570  90 QPSVSARGGLPKDAGDGASES 110
gi 940758345  98 QPAVCARGGFPKDAGDGAAEP 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap