Conserved Protein Domain Family
LCE6A

?
pfam15858: LCE6A 
Late cornified envelope protein 6A family
LCE6A is a family of proteins is found in mammals. It was identified in a large-scale screening experiment as being involved in the barrier function of the epidermis.
Statistics
?
PSSM-Id: 318141
View PSSM: pfam15858
Aligned: 3 rows
Threshold Bit Score: 98.9755
Threshold Setting Gi: 426331559
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 752439896  1 MSQQKQQSWEPPIAPKCSLPQRPNPSLAACSAPCHGPCSGGCDSGSQKPGEQRASSSRKAHRKKPCCLSGGTVYHIKEEE 80
gi 261244931  1 MSQQKPQLSELPNAPIYSPPKGPNLSLSTCSTSCGTSCSAGCSSYSKRLRLQNTVSHKEIHHPQPRCLRGSTTYHCKEEE 80
gi 426331559  1 MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKP---RRA-RQKLRCLSGGTIYHCKEEE 76

                .
gi 752439896 81 C 81
gi 261244931 81 C 81
gi 426331559 77 C 77
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap