Conserved Protein Domain Family
TMEM232

?
pfam15877: TMEM232 
Transmembrane protein family 232
This family of proteins is found in eukaryotes. The function is not known.
Statistics
?
PSSM-Id: 318156
View PSSM: pfam15877
Aligned: 15 rows
Threshold Bit Score: 629.816
Threshold Setting Gi: 972955172
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298352707   41 PSFSISKEFILRFNHTDNPAEEEELLEQARRLIVRSKRKLGLKTLGSGKHVHLPTAWAEVIYLAQCKGEIQDEALNMLHA 120
gi 620952362   11 NRLEIMQHFVLYFNKMKNPETQKYFFELATKMLCRCKKRLGLSSLGLGNHVDLPGAWAEAIVLTQCRGKIQEEALDILYL 90
gi 1033364938  44 nPLELTEEFIQDFNDSLKTEREEKYIELAKKMLARCKRRSGLTTLGCGKYVDLPLAWTEAIMLSQCKGEINEEALEILLI 123
gi 532083267    5 flfPVSANFILKFNQTQDPAEENKLLEHARKNILRCKRKLGLKTLGSGKHVHLPAAWVEVMYLSQCKGEIQEEALNMLHA 84
gi 351714063   41 SLLLIREKFILKFNQTQNPVEKKELLEQARKNILRCKRKLGLSSLGCGKHVHLPFAWTEVIYLAQCKGEIQDEALNMLYA 120
gi 348587408   92 spgIITEKFILKFNQTQNPIEKKALLEQARKNILRCKRRLGLSSLGSGKHVHLPFAWTEVIYLAQCKGEIQDEALNMLFA 171
gi 940710083   99 PPFSITAEFILRFNQTKNLKEKKKLLDLARKILLKCKRKLGLSTLGTGEHVHLPTTWIEISYLAQCKGQIQDEALNVLYA 178
gi 1040162905  44 STFSITNEFILKFNETQDPVEKEELLEIARKSITKCKRKLGLKTLGSGKHVDLPAAWTEVVFLAQCKGEIQDEALNMLYV 123
gi 821470995   41 KALLITKEFIKKFNDSENLEDERLLQDQARKMLFRCKRRLGLSSLGVGKHVDIPAAWIEAIYLAQCKGEIQEEALNMLCA 120
gi 344265426   26 PSYSVTRECILKFNHTENLREKERLKEQLTKNILRCKRRLGLKTLGSGKHVNIPGGWIEATYLAQCKGDIQEEALNVLYD 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298352707  121 SLDHVSFDHDQLPALFFLAESVLYRLCCDAFMKGYLYSVEIKLVKIGYLIFLRLFVFFLHGHLESFKQHLLRLQPYLYAL 200
gi 620952362   91 SLDHAYLNPDHIPVLFFIGESVLFGICSKEARKKYLYSGEIKLIKIGFLTFLRLFIYHLYGVLEGFNEHKLRLHSFLRGL 170
gi 1033364938 124 SLDHAPVATDHIPILFFISESILYKLCYDAVKKPYLFSCEIKFSKLGFLVLLRLLLVHFFDCQNFSEEQKFRLHTGLKAL 203
gi 532083267   85 SLDHASFDCDHLPALFFLAESVLHRFCCDAFVKVFLYSVEIKLAKIGYLIFLRLFIFFLHGHLESFKQHLLRLQPYLYAL 164
gi 351714063  121 SLDYASFDYDHLPALFFVAESVLYRLCCDAFLKDFLYSVEIKLTKIGYLIFLRLFIFFLHGQLANFKGHLLRLQPYSYAL 200
gi 348587408  172 SLDHASLDCDHLHALFFVAESVLYRLCCDAFLKEFLYSVEIKLTKIGYLIFLRLFIFYLHGQLENFKEHLLRLQPYSYAL 251
gi 940710083  179 SLDHASFYYDHPPALFFLAESILYRLCCDAFLKPYLYSVEIKLAKIGYLISLRLFIYFLYGHLESFKEHLLRLQPFLHAL 258
gi 1040162905 124 SLDHISFDYDHLPALFFVAESILYRLCCDALLRTYLYSIEMKLAKIGYLIFLRLFIYFLHGHLESFQPHLLRLQPFLYAL 203
gi 821470995  121 SLDHASLHCSHLSTLFFIAESVLYRICCDASQKSYLYSSEIKLIKIGFLTFLRLFVYHLYGNLEGFETHLLRLQPYLFAL 200
gi 344265426  106 SLDHASFDYCQLPALFFVAESVLYRLCCDAFQKTYLYSVEMKLAKIGYLVFLRLFVFFLHGHLGGFKAHLLRLQQYLNVL 185
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298352707  201 HFSEPSYYKYPNIISNVQFILKTSEIIC--------KRELHSEPF---VES--PDETEDP---YSDL--------NHLQl 256
gi 620952362  171 VHQEDTYYVYPDILFTLHFMQKAGEAIC--------NMELCSETY---SSTlgLSSPNFFqhlLSDY--------GERI- 230
gi 1033364938 204 AACEACYRHYPNILFMVNFMLKAGETIC--------ERVILSESS---ITP--HEDLEEEqkeFDGTspmsidsaAELNp 270
gi 532083267  165 SFSEEPYHKYPSIYSNVQFILKTSEIIC--------KREL-SESIfihEEN--EEEYKNI---DSDV--------EhLPf 222
gi 351714063  201 FSSGESYRKYPNIFSNIQFILKTLEIIC--------ERELLSESGfstGEN--KEGFEDK---DSDM--------AhLQc 259
gi 348587408  252 FASGESYYKYPNIFSNVQFMLKTLQIIC--------GKELFSESVfstVEN--RGgfENT---DSDV--------AhLPs 310
gi 940710083  259 SFSGEIYYMYPNIFSNVQVILKTMEIIC--------KRELPSDTIfsrVEN--KNQHEGT---DSHM--------EhLQd 317
gi 1040162905 204 CFSGESYNQYPNILLQVQFILKISEIIC--------KREHLYGSVfspMGN--QEASGNM---CSDM--------GqLPl 262
gi 821470995  201 YFCEDTYSKYPNILSIISFMKMTGEVICfpgisethEDTDTKQDVifpGM----------------------------Vv 252
gi 344265426  186 SLSEETYYKYPNIFSNVAFILKTSEIIY--------ERVLLSESTfspNGN--TEGYENV---YSDM--------Egg-- 242
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298352707  257 nkr----gyeVNHLLWHSVAAWSCVQNNRPQLTEVLEHLLFYKTQLQTKCWLDSALALMVLGEAAKLDMACLKTLMDLVT 332
gi 620952362  231 ----------INHFLWNCTVAWACVHDNSLQLDDVLKHVISYKHYLHPKYWLDSVLSLVILGEAAKSNMSCLRILLTVMR 300
gi 1033364938 271 eqk----qfkIKPFLWHSLLAWVCVHNSCSKIDEVLRHVLFYKEQLHQKDWLESVLGLMVLGEAAKLSMSCLKVLMDLMK 346
gi 532083267  223 npg----gyeVSHLLWHCVAVWSCVQNNSPQLNNVLEHLIFHKKQLQKKCWLDSALALFVLGEAAKLNMACLRALMEIVK 298
gi 351714063  260 nhg----syeVNPLLWHCVACWFCVQSNSPQLSSVLEHLILHKMQLQKKCWLDLVLALLVLGEAAKLNMACLKTFMDLMR 335
gi 348587408  311 nhg----eyeLNPLLWHCVAAWFCVQSNSPQLSSVLDHLLLHKMQHQKNYWLDLIVALLVLGEAAKLNMTCLKTLMELMR 386
gi 940710083  318 nqk----syeVNNLLWHCIAVWTCVQKNSPHLNNVLEHLTFHKTQLQNKCWMDSALALLVLGEAAKLNMACLKTLMDIMR 393
gi 1040162905 263 dqr----gyeVNHLLWHSVAAWSCVQRDNPQLDDVLQHLLSQKTQLQKKCWLDSALALLVLGEAAKLNLACLRTLMDLLR 338
gi 821470995  253 nskpyskrqeVSHLLWHCIVVWSCVQNQTTQLNEVLEHLLKHKKQLQKKFCLESILCFFILGDAAKLNMSCLKIFMNLGK 332
gi 344265426  243 --------yeVNHLLWHCVAAWSCVQNNSPKLNNVLEHLNFHKTQLQNKCWLDSALALLVLAEAAKLNMVCLKALMDLVR 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298352707  333 DFLENILSAQNQEENyNIYDTSWASEIVFTYTTIIAEVCLYAATSDLRKTALIGFCACKSPQQGISLTDK-SEELPELDG 411
gi 620952362  301 DFISNCISLQKQATS-KAKDIASSWEIVYIYTFILEDICLRASTLTLKKTALLGFWGSVYGSQKLGSRVKvAQEYRGLKG 379
gi 1033364938 347 DFISSSILLCKQQTSdKEDFSCWQWQVAYIYTSILKEISLQGLSADLQKTAFLGFCDCIRERKN----------DKGLRG 416
gi 532083267  299 DFLSSIMSLHSQKENcKVDDLSWTWIIIYTYTTIVAEICLYAATSDLRKTALVGFCDCNSSRKNTVFMEK-SEKEPELQE 377
gi 351714063  336 DFLLSIMSVEKQKERcTGDDLSWAWSVVHTYTTIIAEVCLYAATSDLRKTAFLGLCGCKRPQKNILLIDKsSAGIPHKIA 415
gi 348587408  387 DFLLSIMSVEKQEDMcEGDDLCWSWNVVHTYTTIIAEICLYAATSDLRKTAFIGVGGYKCPRKKILLIDE--SEQPELQE 464
gi 940710083  394 DFLLTIMSVQNQKENgSV-DFSWAWIIVSIYITILTEICLYAAISNLRKTAFIGFCDCKSSKKYILPLDK-PEEQPELRE 471
gi 1040162905 339 DFISSILSIQNQQESnNVSDFSSAWNIVTIYTTILSEICLYASTSDLRKTALIGFCDCKNSRKSILLMDK-PEEEPELRG 417
gi 821470995  333 DFILSCISPQKQEEN-KDDDPSWEWIIAYMYITVLGDICLHATTSILRKIAYTGFYEHENTSKYLERKNIkSMEPMELKE 411
gi 344265426  315 DFILSIMSAQNQEESyKVNDFSWAWNIVYTYVTILAEICLYAATSDLRKTVFIGFCGCKSSQKNISLKDTvSEDEPVLRE 394
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 298352707  412 ASILTLLKYFSSRISDNCEKVIWIGYYGIVYNLVKMSWELQGEQDQDGLRNMIWQTLQKIKDYEQDPRIRCALVIAQ 488
gi 620952362  380 GSVLDLLQYYLSQESDDCNQLYWTIRYNLFSNLIKMFWEFSGDDIRDALHGIVWKAIQKIKESEKDSRVIEALKISE 456
gi 1033364938 417 ASLLDLLCYCSS--PDNYHDPFWVIRYGVIYNLVLLRNELSGHVNQEGLRNAAWRALQQQKGIEKETRVLNAVKVAE 491
gi 532083267  378 TNILSLFEYFSSKISDDCHQVIFVGYYGLVYNMVKMLWELRDDEEQDGFRNTIWKTLQITKDYEKDERIQNAINIAQ 454
gi 351714063  416 TCSASVNMLYPSLRTDR-DQLVWIGYYGLVYNLVKMSWELQGDVEQDGLGNMIWQTLQKTKDYEKDGRILNGINIAQ 491
gi 348587408  465 TSILHLLEFFSSKISDNCDQVVWIGYYGIVYNLVKMSWELQGDMEEDGLGNMIWQTLQKTKDYEKDARILNAINIAQ 541
gi 940710083  472 TSFLGLLDYFSSKMSDNCEEVIWIGYYNLVYNLVKMSWELRGDEEQDGLRNVIWQTLQKTKNHEKDERIHNALNIAE 548
gi 1040162905 418 TSVLSLLEYFSSKISDNCDQVIWRGYYSIVYNLVKMSWELQGDEEQDGFRNVIWQTLQKTKECEKDVRIQNAIRVAQ 494
gi 821470995  412 ANFLDLLTYFSSQISDNCCQLIWTVYYGLIYNLVKMIRELYGDEKQDGLRNLLWKILQRIKCDEKDVRILTALDVAE 488
gi 344265426  395 ASVLGLLKYFSSKISENCNQLIWTGYYGLVYNLVRMSWELRGDEEQDGLRNTIWQTLQKTKDHEKDERIRIAVKIAQ 471
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap