Conserved Protein Domain Family
HMMR_N

?
pfam15905: HMMR_N 
Hyaluronan mediated motility receptor N-terminal
HMMR_N is the N-terminal region of eukaryotic hyaluronan-mediated motility receptor proteins. The protein is functionally associated with BRCA1 and thus predicted to be a common, low-penetrance breast cancer candidate.
Statistics
?
PSSM-Id: 318177
View PSSM: pfam15905
Aligned: 11 rows
Threshold Bit Score: 215.099
Threshold Setting Gi: 340383890
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341941126    16 GCAPSPGAYDVKTSEATKGPVSFQKSQRFKNQRE------SQQNLNIDKDTTLLASAKKAKKSVSKK------DSQKND- 82
gi 637249677    16 ACAPPPGSYDVKTSDASKGPISFEKSERFRVQTGdv---eTQPNRSHMKPPPSPANGRKVTLQKSKKpnssgmKVEKDLt 92
gi 340383890    13 dTIPPVGAYDV-STDAKRIGGTFEKGSRFRQ---------SSPSSDRSGDSSTTSASSKYSSSSLKRp-----KQQTKPa 77
gi 768937797    16 GCAPPPGTYEIKPED-SKGAASFDKSDRFKLVKaaalrppsptr-----nalvspvrrtmSVDGLVEs-----SSAKKEk 84
gi 768937795    16 GCAPPPGTYEIKPED-SKGAASFDKSDRFKLVKaaalrppsptr-----nalvspvrrtmSVDGLVEs-----SSAKKEk 84
gi 348516868    16 GCAPPPGSYEIKTGD-LKGAASFDKSDRFKPPKaadgaamPPPPPSPSRNTLVSPVRRTLSLDVLPEg-----SSAKKDr 89
gi 836941252    16 GCAPPPGTYDVKSGD-LKGAASFHKAERFKTAPk------NVPLPSPSKDVLMSPVRRTMSVDGLADa-----LSSKKDk 83
gi 928132361    16 GCAPSPGAYDVKTSEVLKGPVSFQKSQRFKKQKe------SQQNLNVDRDTTLPASARKVKTLGLKK------ESQKND- 82
gi 525012710    19 ACTPLQGSHSAKPSDGVGSLLSSEACQGVRKQK-------SVANLSSEKSAPTPVTARRLTSLGSTPang-ivKTKKDLm 90
gi 611974557    16 GRVPSPGAYDVKTSEIPKGPVSFEKSQRFRRHQaaf--meNQEGINNGKDRLTTTTAKNTKPLELKT------KSQKNVk 87
gi 1019073637      --------------------------------------------------------------------------------
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341941126    83 -------KDVK-------RLEKEIRALLQERGTQDKRIQDMESELEKTEAKLNAAVREKTSLSASNASLEKRLTELTRAN 148
gi 637249677    93 vl--kdmKKQK-------ELEKEIRLLTGERSQQDKRLQALEEDLAKAEAKLCAVVREKTSLLENVASLKKQLLDLSRTN 163
gi 340383890    78 skttnssSDHHslpgniaELEQQIRKLVLENTELNKQVSQGKQEAVRLDGKLQTLTKDKLELQAAIAVLERENRDLVRGK 157
gi 768937797    85 igmslakKQQR-------QLEKEMRSLVQQRGEQDRRLLILEEELKKVEAKLLAAVRERTSLAANVTTLERQRAELRKAN 157
gi 768937795    85 igmslakKQQR-------QLEKEMRSLVQQRGEQDRRLLILEEELKKVEAKLLAAVRERTSLAANVTTLERQRAELRKAN 157
gi 348516868    90 ngmtaerKQQK-------LLEKEIRSLVQQRGEQDRRLLSLEEELKKVEAKLLAAIRERTGLTASVTTLERQRAELKKVN 162
gi 836941252    84 ssftlemKHQR-------LLEKEIRSLVQQRGEQDRRLLALEEELKKLESKLLVAVREKTGLAANVISLERQLAELKKAN 156
gi 928132361    83 -------KDLK-------ILEKEIRVLVQERGAQDKQIQDLEAELEKVEAKLNAAVREKTSLSASNASLEKQLIELTRSN 148
gi 525012710    91 lm--kekKKQK-------ALEKEIRALVRERGEQDKKLKALDEDLVKIEAKLSAAVQEKTSLSANVACLKKQLLEITRSN 161
gi 611974557    88 e-----lKKLK-------IQEKEIRALVQERGIQNKHLQDLEAEFEKMEAKLNIAVREKTSLLANIASLEKQLIELTRAN 155
gi 1019073637    1 ------------------MLEKEIRDLVKERGMQDKRHRDLEAELEKTEAKLNAAVREKTSLSANIASLEKQLMELTRAN 62
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341941126   149 ELLKAKFSEDGH-QKNMRALSLELMKLRNKRETKmRSMMVKQEGMELKLQATQKDLTESKGKIVQLEGKLVSIEKEkIDE 227
gi 637249677   164 ELLKTKCFEDGT-QKKMSTLMVEVMKLRHRLTAK-RVTFVRQRDMESKPNATQEPMEHSKEKVAQLEEQLMEMYKQ-AEE 240
gi 340383890   158 DILQAKAAATPD-NKRLQT---ELTQTHKELEATqKEV----QKLTGQLQSTQKHL---KAEVSNLKEKN-------NEQ 219
gi 768937797   158 EFLKSKVSADTS-KKRINSLTMDLMEARNTLDTKnKELSVLQINTEAQLKVLEADLKSAKSAVTALKDRnkdledlheag 236
gi 768937795   158 EFLKSKVSADTS-KKRINSLTMDLMEARNTLDTKnKELSVLQINTEAQLKVLEADLKSAKSAVTALKDRNKDLEDLheag 236
gi 348516868   163 EFLKNKVSADTT-KKRINSLTMELMEARNTLDVKnQEFSVLQINTEGQIKVLETDLQAARATLAALKDRNKDLEDLhQVT 241
gi 836941252   157 EFLKTKVSADIT-KKKINALSMELIEAKNKLDAKdKELSFLQISSEGKVKVLETDLETAKTTFRVLQDRNKDLEDLhQET 235
gi 928132361   149 ELLKSKFSEDNN-QKTMRILSLELMKLRNKRETKmRNMMAKQEGMEVKLQVTQKNLEESQGKIAQLEGKLVSIEKEkTDE 227
gi 525012710   162 ELLKSKLSEDGV-QKKMSSLCMELMKLRNMRDAKeKTALAKQEDMEMKLQEVQRNLEHSKGKVAQLQQKLSATEREkVEE 240
gi 611974557   156 EILKIKFSEDGNhQKKISLLSLELMKLKNKMETKkKNVVDKQEGMEIKLYSAQKNFHHFQGNLSQLEEKIVTSEKEnIEE 235
gi 1019073637   63 EFLKLKFSDDGT-QKKMSSLSMEVMKLRSKMEAKtKSAAAKQEDMEMKLQLAQRNLQQTQGIVAQIEEKLLSTEKEiVEE 141
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341941126   228 KCETEKLLEYIQEISCASDQV-EKCKVDIAQLEEDLKEKDREILSLKQSLEENIT-FSKQIEDLTVKCQLLE------TE 299
gi 637249677   241 KYDSLKLLEYITELGNVAEQVgDKYNLDIAYLEEIIEAKNKNIETLQSALQQKETmLSTQVEEMNEKCKMAE------EQ 314
gi 340383890   220 KAHVQQQVAEIKRIQNEREQL----SLDLQKSKELAATQASHLESVQSELSASKQhLEATTNERDELVKELEtlkvklSS 295
gi 768937797   237 kahnqeledensklqavihglkqeikviqeyldtandqiqelrlqlrekakdnnavspeeqvklleaqlkqsstelentk 316
gi 768937795   237 kahnqeledenskLQAVIHGL----KQEIKVIQEYLDTANDQIQelrlqlreka--kdnnavspeEQVKLLE------AQ 304
gi 348516868   242 KSQNEELENENARLHAVIREL----REEIRVVQGYLDAANDENQELRLKIQEKTQ--YTVAGSQVEKLKQLE------SE 309
gi 836941252   236 RAQNELLENEMDKLHNIIQEL----REEIKALQSYLDSANEEIQDLRIKLQDKST-MERRVSDAQENLSEVE------QK 304
gi 928132361   228 KSETEKLLEYIEEISCASDQV-EKYKLDIAQLEENLKEKNHEVVSLKQSLEENVVlLSKQVEDLNAKCQLLE------KE 300
gi 525012710   241 KSDTEKLLEYITELSSVAETA-EKYKLEVTQMEETLSKKDQEIEILRNTLKAKEEeSCKLMKDLNERCQLLQ------QE 313
gi 611974557   236 KLEIENLLKYITEISCTSDQM-EKYKLDIVQLEETLNQRNQEILVLKQSLDENVDvLSKNIKDLNTRCDTLE------KE 308
gi 1019073637  142 KSDTGRLLDYIEQLSCLGER--EKYKEDIFYLEEIFKEKNNELSILKNSLEEKDCaLSRKIKELTSACQLLE------EE 213
                          330       340
                   ....*....|....*....|....*...
gi 341941126   300 RDNLVSKDRERAETLSAEMQILTERLAL 327
gi 637249677   315 KEKMLTEYEVKKQTMNVEMECLKEQLNL 342
gi 340383890   296 TEEKLREEETKSQGYLKELGEMEETVTS 323
gi 768937797   317 qvlkqkeedaqiyqqelqalkgclleme 344
gi 768937795   305 LK-----------QSSTELENTKQVLKQ 321
gi 348516868   310 LE-----------RRVSELETTQDALRQ 326
gi 836941252   305 LE-----------KCTAELQECQEALKV 321
gi 928132361   301 KEDLVNRDRVRDETLNSEMQNLKENLIL 328
gi 525012710   314 KEKELSEAEGQFLSRNAEIEDLKKKIDL 341
gi 611974557   309 KEELVRQGKEQEQNLSTEILSLKERLTL 336
gi 1019073637  214 NGRlIAEHKEQEHNLNVSLQSLKEKLQL 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap