Conserved Protein Domain Family
zf-NOSIP

?
pfam15906: zf-NOSIP 
Zinc-finger of nitric oxide synthase-interacting protein
Statistics
?
PSSM-Id: 318178
View PSSM: pfam15906
Aligned: 2 rows
Threshold Bit Score: 163.66
Threshold Setting Gi: 82196722
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 82196722    4 HGKNCTAGAVYTYHEKRKDTAASGYGTQSVRLGKDAIKDFDCCSLSLQPCRDPVLTEDGYLYEKEAILQYILHQK 78
gi 928125802   4 HGKNCTAGAVYTYHEKKKDTAASGYGTQNIQLIRDAVKDFNCCCLSLQACHDPVVTPDGYLYEREAILEYILHQK 78
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap