4C8V


Conserved Protein Domain Family
Furin-like_2

?
pfam15913: Furin-like_2 
Click on image for an interactive view with Cn3D
Furin-like repeat, cysteine-rich
The furin-like cysteine rich region has been found in a variety of proteins from eukaryotes that are involved in the mechanism of signal transduction by receptor tyrosine kinases, which involves receptor aggregation.
Statistics
?
PSSM-Id: 318185
View PSSM: pfam15913
Aligned: 16 rows
Threshold Bit Score: 152.922
Threshold Setting Gi: 768921455
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4C8V_A          9 C-K-GCLSCSKDNGCLRCQPKLFFYLRREGMRQYGECLQSCPPGYYGVRGPDM-NRCSRCRIeNCDSCFSRDFCIKCKSG 85
gi 1033373321  36 C-T-GCIMCSEDNGCISCQQKLFLIIWRDGMRQYGACVHACPPGYFGVRGQEV-NRCIKCRSpNCESCFSKDFCIKCKQQ 112
gi 637349853   86 cdK-GCDLCSEFNGCLRCCPRLFILLERNDIRQTGICLQSCPSGYFGLRNPDM-NKCIKCKIeNCEECFSRNFCTKCKEG 163
gi 189230352   39 caK-GCDLCSEFNGCMKCLPKLFILLERNDIRQTGICLQSCPQGYFDDRNREN-NRCLKCKInNCETCFSKNFCTKCKEG 116
gi 525021756   40 CaR-GCDLCSEFNGCLRCSPKLFILLERNDIRQIGICLPSCPLGYFGLRNTDM-NKCIKCKIeNCESCFSRNFCTKCKEG 117
gi 765146239   41 C-PkGCDRCSEYNGCVKCKPKLFIFLERNDIRQVGVCLASCPVGYFGMRNPEGnNRCTQCKIdNCEACFNRNFCTKCKEG 119
gi 351694350   35 L-S-FQLSCGSERGCMACQQRLFLLIRREGIRQYGKCVHDCPLGFFGIRGQEV-NRCKKCGA-TCDSCFSQDFCIRCKRR 110
gi 366047588   35 C-T-GCVLCSEENGCITCHHRLFLLIWRDGIRQYGVCVHTCPPGYFGVRGLEV-NRCTKCRSpSCESCFSKDFCMKCKEK 111
gi 410904935   42 C-K-GCSMCSRDNGCVNCQPKLFLFLRRERMRQYGECLHDCPAGYYGMRSPEL-NMCSRCRIeNCESCFSKDFCTKCKSG 118
gi 58332624    40 C-K-GCLSCSKDNGCLRCQPKLFFYLRREGMRQYGECLQSCPPGYYGVRGPDM-NRCSRCRIeNCDSCFSRDFCIKCKSG 116
                          90       100       110
                  ....*....|....*....|....*....|..
4C8V_A         86 FYSHKGQCFEECPEGFAPlDDTMVCV--D--G 113
gi 1033373321 113 FYLHKGKCLSTCPLDTIAqPSTQECL--S--K 140
gi 637349853  164 FHLHKGRCY-NCTKDFSAaNSTVECN--SpaQ 192
gi 189230352  117 FYSHKGSCYSSCPEGFSAvNGTAECS--Sv-Q 145
gi 525021756  118 LYLHKGRCYVTCPEGYAAaNGTMECSspA--Q 147
gi 765146239  120 LYSHSGRCYVSCPPGQRTaNETMECV--G--Q 147
gi 351694350  111 FFLHKGKCLPTCPPGTLThQSTRECQ--E--E 138
gi 366047588  112 FYLHKGQCFRQCPPSTAAqPGTRECQ--E--T 139
gi 410904935  119 FYLHKGRCFDRCPEGFAPlDETMECG--E--G 146
gi 58332624   117 FYSHKGQCFEECPEGFAPlDDTMVCV--D--G 144
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap