Conserved Protein Domain Family
DUF4748

?
pfam15932: DUF4748 
Domain of unknown function (DUF4748)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 114 and 139 amino acids in length.
Statistics
?
PSSM-Id: 318202
View PSSM: pfam15932
Aligned: 22 rows
Threshold Bit Score: 62.3411
Threshold Setting Gi: 636753669
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 82267203    73 PMTKIGYAWMIGLPTGIISFILAKRQVDKNRLKQLKI-RQRMKKSNEGAYE 122
gi 74817294     5 TVRRITIAWALVTVAGIGSFVYAKRLVDKQRYEAMKV-RERMKNCNTGDYE 54
gi 121955221    5 hLAKIGIGWGFITVAGISGFVYSKRTVDKNRYENMKI-RERMRKSNEGEYL 54
gi 1016645883  71 PMKAVGVAWAIGFPCGILLFILTKREVDKNRLKQMKA-RQNMRASNTGEYE 120
gi 620968565   67 PMRPVGLAWAIGFPCGILLFVFTKRQVDRNRAKQLRA-RQNMRASNTGAYE 116
gi 677430644   19 PMKPVGVAWAIGLPSGIILFLLAKREVDKNRLEQLKI-RRKMMEANQGEYE 68
gi 399171454   36 TIKSVWYGWGVLCLAGGGAYYFAKQEINAERQAKVEAyNKKQRAIREGTYg 86
gi 927428718    3 TVKSFWLGWGSLCVAGGGAYYFAKQQIRADRQAKLEAhRQKIAANKAFEYE 53
gi 685410345    3 TVKSFWLGWGSLCLAGGGAYFFAKRSINADRQARWEDqKRKRAYVESLEhs 53
gi 597586485    3 TIKSFWVGWGSL--SGGGAYYFAKKSINADRQAKFEAgQKKRAEQEALEYS 51
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap