Conserved Protein Domain Family
Yuri_gagarin

?
pfam15934: Yuri_gagarin 
Yuri gagarin
The yuri gagarin protein found in Drosophila, it plays roles in spermatogenesis.
Statistics
?
PSSM-Id: 318204
View PSSM: pfam15934
Aligned: 3 rows
Threshold Bit Score: 349.259
Threshold Setting Gi: 442627908
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 968079879  514 ILKELADLICRLRSMEFSYSDIYTESSTRNPFCAAVMDIFENNNRQEQQLKTfknekdaqptpptppttattatttietp 593
gi 442627908  166 VLREIAELICSLGSKEFSYNEIYDESSKENPFCTTIADMFARKFEQEQNQVE---------------------------- 217
gi 964106863  489 ILKEIADLICKLRSTDFSYNEIYNETSTENPFCVAIMEMFDEKSEQTEKEYEsl-------------------------- 542
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 968079879  594 spdsgedcphrqqledtllhcqtqkeilqvtrdnylsiidefkrdleeltvQNQRLACEIDNLHTTLKDRDHQIKQLHDM 673
gi 442627908  218 ---------------------------------------------------INGQLSCQIKGLQENLKDRDNQISQLQSM 246
gi 964106863  543 --------------------------------------------------aANERLVCQISALKETLNDRNELINHLQSM 572
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 968079879  674 ITGFNDIHENTRLKNEIYDLKQKNCVQARVVRKMGLELKGEEEQRIELCDKYEKLLGSFEEQCKELKRANSRVNTLQERL 753
gi 442627908  247 INSYSDFSENNRLKEEMHVLKQKNCDLSRQLRDLPSLLKNQENQSVELCTKYESLMASFEDQCQELKDAKRKAQSLQTRL 326
gi 964106863  573 IGNYSDMSENNRLKEENHDLKMKNSENIRKAREIAEQLNGQVTQRVELVNKYESLSSSFEEQCQELKGANRRVQSLQTRL 652
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 968079879  754 SQVEKLQEELRTERNILREEVIALKEKDAKRNGHERALCDQLKCCRTEIEQSRTLIRNMQCHLKLEEAHH 823
gi 442627908  327 DQVEQLQDELRTERKILREEVVALKEKEAVSSGRERALQDQQKSAQLEMEKMRTLVRKMQSHLQLDDIRH 396
gi 964106863  653 CQVEKLQEELRTERKMLREEVIALKEKDACSVGRERALQDQLRCSQMDLDKSRCLIRNMQSQLQQQDKLH 722
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap