Conserved Protein Domain Family
DUF4753

?
pfam15945: DUF4753 
Domain of unknown function (DUF4753)
This family of proteins is found in bacteria. Proteins in this family are approximately 50 amino acids in length.
Statistics
?
PSSM-Id: 318212
View PSSM: pfam15945
Aligned: 2 rows
Threshold Bit Score: 66.5141
Threshold Setting Gi: 282951364
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*
gi 282951364  1 MVLGQDNTLECSILFRSLCRYFMLKNALFFVYLWRKAEYYLFLID 45
2_pfamImport  1 MVLGQDNTLECSILFRSLCRYFMLKNALFFVYLWRKAEYYLFLID 45
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap