Conserved Protein Domain Family
DUF4765

?
pfam15962: DUF4765 
Domain of unknown function (DUF4765)
This domain family is found in bacteria, and is approximately 90 amino acids in length.
Statistics
?
PSSM-Id: 318227
View PSSM: pfam15962
Aligned: 5 rows
Threshold Bit Score: 1806.71
Threshold Setting Gi: 485743856
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332   10 ESQQTVQIQAIRSWDTIPYLSMLDGLYQDDIFHEQVSNLPEEYIKLDEIAKDEEKNRLNIYDFFFEPTHEIIYEDIKSTL 89
gi 502672854   11 APTSLSKTEDIKSWDTEKYLKTLSKFNNDNIFNDQISKITEKQYDFDKTATNENYYNLNLYDIYFQPCSNIIEENITRIL 90
gi 485743856   10 TSRTHGSFSTIKSWDTMNYIKHLIRHTNDPVFEEQFYKITQSHIDFDKRAKDEKNDTINIYDNFFYSSNDDLDSKIRSML 89
gi 447045763   12 PSRQTLKIKGIGTRDTMQYLSALGGTYQDAIFNEQTSNLPDEYIRLDEMARDEKQYNLNIYEFFFEPTPELICEEIKTTL 91
gi 447068248   12 PVQQKLNTKGIKTWDTIQYLSALDRAHKDTVFHEQISNLPEEYIHLDEMARDEKEYGLNIYEFFFESTAEIICEDIKSTL 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332   90 DFYYSNSATFRRLVNYKVERSINDDIdtNKCEVKISLNYSYKNIDGGRGYLSLPFDKNGYPIPPDFHNCVNgITSEKLLL 169
gi 502672854   91 QFQYSNSPTFRRLVNYHTDNLPNYDI--NKCQIYITNTFAYNKKEDSVSELFIALDEKGNFIVPKTESLEE-ISPEKILL 167
gi 485743856   90 NNLYEKSLTFRRIINYYVKEINLSDYgfLKCKILPAYAYNYEMENDAPPKILIPIDHNLNFIDAK-YNGETyRGNEEFAI 168
gi 447045763   92 DFHYLNSPTFRRLVNYKVDYIINNDIdtNKCEVKISPNYSYENAEGGRGYLSMPFDINGFPIAPDFYNCENkITSEKLLL 171
gi 447068248   92 DFYYLKSPTFRRLVNYRVNYSIGNDIdtSKCEVIVSPNYSYQNTEGSSVYLSLPFDKKGFPINPESNDCDNnISSEKVLL 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  170 DLFLKHILHDHLNANGEVtNVYANVIYKEIDPAAIAHTSSCFSQVTMSGEHELFNVDSVTVPPKSTEQIISEGKEIQRQI 249
gi 502672854  168 NFFLKHISNPDILGYDDI-DTYTNIIFKELSPQAIAHTSKSFQHASVRDKYKLYDCENSTKQIDNIEQVISKGSTLQKEF 246
gi 485743856  169 NLFLQHILHNDIQEQTSI-DLYTSIINKELDSNRKSYNNEIFNNFSFDKSVKL---NSYNYIADDIEQVIDKGSKVQLEV 244
gi 447045763  172 DLFLKHILHGDLNSNNEVtCIFSNVIYKEIDPVAIAHTLLCFSPVKVNSEHELFNIDSITALPKSTEQIIYEGNEIQKRI 251
gi 447068248  172 DLFLKHILYDDLKVDHEVtNLYSNVIYKEIDSTAMAHASLCFSQAAVSDKHELFNIDSVTVQPKSTEQVIFAGEEIQKQI 251
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  250 FLSSHSSNHLQPVTIHKMDRSIKNIAVTGLLLSSRLavtsgdYRIKNGNSEGENNFLPVKELQRYERAL------PEDHP 323
gi 502672854  247 FDSYIKNKELDPIPSQKKGIQFKKIALNGLLLTSGL------FQTLNNNQHSGNSNSLDKINVRHSRSL------PEEHS 314
gi 485743856  245 YNLLSEEKIFEHKIMNNWTRSIKNILTTYLFMSSGA--------VTARNVQTFSPTINNESRIRLPRALpvghpyPEEHK 316
gi 447045763  252 LSSFHGSNNFQPGAVHKIERNIKSIAVTSLLLSSRVtampdsAEIKDKYTKPDGNHPLYKEQQRYPRAL------PEDHP 325
gi 447068248  252 LFFFERENNFQPATAHKMERNIKNIAVTGLLLSSRLtia-dgYGRKNDNSENKNNFSSDKEPLRYARAL------PEDHP 324
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  324 APTtepNLAGKVLDGLFEHFTSMAGGRLISILKLLVKEQEANSYKRGYHELLAFSQTG-QWTHDGRAIAAEYMFKGLLVH 402
gi 502672854  315 APA---ETKSSSIVKGINEFILKKAASLYNLLTNLELELQLENYIRGYHELLAFSQTG-IWTRNGRDAARNYIVEIMKQH 390
gi 485743856  317 ASGfspFMMGGLSGDILPEILTGNGPSIF------FNGKHNNQHDGAFGKIIDFTQNGnKISAKDKEIIKRYIFDKINVL 390
gi 447045763  326 AQQperDYVREIF---YNHGGLANQVLLANQVLSVLSSVREDLYVKGYHELLVFSQTG-KWPQNGREIASEYMFEKIKNY 401
gi 447068248  325 APNmepHPLGKMIDGIVEHSSFAAGISLFETLKKIGDEQLMNDYKRGYHELLVFSQTG-QWTHGGRRLTAEYMFNGLIIH 403
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  403 LSD-RLIVLGEGSFISVLSFVRENIQHQYKIYELMARDMLVHPMH-----FSTEPEPLMIDRPLWTR---ESHYAKVLYE 473
gi 502672854  391 FYK-FEIEYNSGRVVFFQDFIEKHREYEYNIYETFARDIIVHPLP-----FDLDYAPPEKGGIIRSEp--ANHYMQTVRQ 462
gi 485743856  391 IKE-YFIRTGKNSHTPFEVFIKERLFNQYDIFKTLARDILAHPLViydagYKNYHESLNAAIAINSRplqEIHYGDVLYH 469
gi 447045763  402 IEKgTTITLHNGRLITFYQFIIDRLECQYEMFEVLARDMVVHPE---------------------TKe--SGHYLHHLKR 458
gi 447068248  404 LNE-IEILINDGGKVSFEHFVREHIEHQYKIYELIARDMLVHPIYirsriFATRRIASA------LAn--ESHYTKVLNQ 474
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  474 KFPAISGSSFDVFYGKDAIITALEIVSFNRQERgk-saFNKKRMNHLFKLIQLVIHHLSSNGGDRVLLSPEGIKNNFIIM 552
gi 502672854  463 KFSHSAPLHFDNLYGKESIFLSVALHDLKSNKK-----LSKRDFEHLFKIAQLVIHHLSKDGGDKILCSSYGVKYHRLIL 537
gi 485743856  470 YHKNDISLGVDTLYGRESFDIVLDAMNVYRKSKkm-rvISNNEMKKSIKISELVIHNIIKKGLTNCLLKKDVLNARYDLI 548
gi 447045763  459 KFITPHTPSFEKLYGRNVISRVLEDINLYRKTTrksklLNHRQMRALFKIAQLVIHHLSRNGGDMKLLEHNIRKQNYVII 538
gi 447068248  475 KFPEISSSNFDTFYGKEAIFTALKIVNYYREEKgm-ptFNSKKMKDLFKRVQLVIRHLSRNGGDKILLSPDGIKYNFSIM 553
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  553 RNIIFWCANIT--GPINDKKIDTIARKIVVNNKFTKGVKSTLPK----SNDPLILLMKAAINKQLHWAEKYYRAETHMKE 626
gi 502672854  538 NEIVTRCKHHQ--RHINESIIEKISLAIITNNDLSNQIKSKILKlnsqKNYCNPWLMILATEKQLSWAEAHYKAQKHIES 615
gi 485743856  549 RDILRYSLNIR--QGIKHDDVNRIAENIIKKYGITEGMNPKPR-----NARISKELLLLAVDRQIEWAKKHFITKDVLEN 621
gi 447045763  539 LTILQKSMNLKnsGSVKDRDIKIISRNIMVNNKLTRHIEEVIRNn---GNGIQLRLIKLAIHKQLDWVEKHYKSEEHIKK 615
gi 447068248  554 RNIIYWCAKIT--GPVNDKKINALSRKIVVNNEFSRHIKSLFPR----GNGFLELLMKAAIDTQLNWAEKYYKAVTHVKD 627
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  627 HMQECDILGLMDINKMMQEAVVGLIHEISDIAQSSWLTLEEQHERQAQALESFKEKLSSMNGGQEFVYAFNKIIQEGLGG 706
gi 502672854  616 HIQDCELLGLMDTNKMVRDAITGFIHQINEITESSWMSSEEQHAKKILALEMFKTKISTLNGGQGFVYGFNKVIQEGLGG 695
gi 485743856  622 VVSKCDLSSIFNVNKVLQNTILEFVHEINNISSARWMSKSEKNNKQKEAIEKFKKEVSHMNGGQQFIWGFDKVIQEGLSG 701
gi 447045763  616 HMEECDILGTFDMNKMVKSAVTSFIHEAQDISASIWLTTEQKHNQQVQALERFKSKVSSMNDGQQFVYGFNKVIQEGLGG 695
gi 447068248  628 HIQDCDVLGLMNINKMLRDTVVGLIHEISDIAQSSWLTAEDQHEKQVQALEAFKSKVSSMDGGQAFVYGFDKVIQEGLWG 707
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  707 LIELSFDLDDTIHHRTTSSLSPAARAGLHLLGTVWNIVMGLVPGFNALAGTSSILNRAVVDNSADVCGYVQDIIRIGMEA 786
gi 502672854  696 LIELSFDIDDEWHHRALSSLSPASRNGLHLLGTIWNIVMSAVPGFNALAGTSSILNHAVVEKSTDVCSYIQDAIRIGMEA 775
gi 485743856  702 LIELSIDINDSTNHRDKSSLSPDGRAVLHFLGTIWNMAMGAVPGYNALSGVSSILHSAIVKESSNICDYIQGAVRIGMDF 781
gi 447045763  696 LIELSFDIDDSRHHRTESSLSPASREGLHLLGTIWNIATSIVPGFNALAGTSSILNRAIVEKSTDVCGYIQDVIRIGMEA 775
gi 447068248  708 LIELSFDIDDTVHHRTVSSLSPASRAGLHFLGTIWNIVMSFVPGFNALAGTSSILNRAIVEKSTDVCGYIQDVIRIGMEA 787
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  787 VPVAGAKFTERAANAKYTGLRFVENKIQRGVVRAPIQKGSNYKTIESIENTDFIYQKSNQKVLELGPAGNDGLYRATGFD 866
gi 502672854  776 VPVAESKFTKKSSNSKYIGLRFVEEKINKNLINEPLQRGSSYRVIESIENTDFIYQKITKKILELMTTENNELYSATGFN 855
gi 485743856  782 VPGTRSDLHSRSLQIKYEALKHIEKNINDNIIYHPSNNANFYSVIESIDGNDFIYNEKQSKILEMKQDRGGNRYSAVDLN 861
gi 447045763  776 APVAEAKFTERASNAKYTGLRFLENKIERGVIRSPIQKGSNYKVIESIENIDFIYQKSTNKILELNPEGNDGLYRATGFN 855
gi 447068248  788 APVAEAKFTERASNAKYTGLRFVENKIERGVIRSPIQKGSNYKVIESIENIDFIYQKRNNKILELNPEGNDGLYRATGFN 867
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  867 KETYGYYKPSGEGFYRKQASYPPLSSEAPNTIKYGDRELVLTKEPGSETYRATYSDSGKDSAMTFYRSSDGRFYQASGLK 946
gi 502672854  856 NENYGYYKRSGDGFYRKQHSFQPLSKETPNKITYNNRELELIKESNSEIYCGTFTDNGKNSIVKFYKSSDGSFYQAEGLK 935
gi 485743856  862 SSKYGYYEKVGGGFYRYIESFNPISSETPNKIVYKGESVDLTKEPNSELYSGRYSINNKQVNVYFFRDADGTFYKSEGLH 941
gi 447045763  856 KETHGYYKQSGEGFYRKQKSFSPLSTEAPNTIKYGEREIVLSKEPGSETYQGTFSDTGKNVGMTFYRTSDGKFYQASGLK 935
gi 447068248  868 KETHGYYKQSGEGFYRKQKSFSPLSTEAPNTIKYGEREIVLSKEPGSETYQGTFSDTGKNVGMTFYRTSDGKFYQASGLK 947
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332  947 GGGLIRHIDKPYSELREGDAGYDEELLDITDDSPLLEDILASLSEDLYPTSEENVQSIYKKYQSGDAAAGETEVVLCRGT 1026
gi 502672854  936 GGGLIRHTDKPYSELKEGDIGYDEELLDITDDSPELEETLPAISEDLYPSEEENVQNIYSKFKSGDIEAGMTEVTLCRGT 1015
gi 485743856  942 GGGVIRYIDKPYSQLREGDIGYDEDLLDIYDDSPVLEDTLPALSSEIVPTPEHSIKQIYSKIKEGHIELSDSDIILCRGT 1021
gi 447045763  936 GGGPIRHVDKPYSELREGDVGYDEELLDISDDSPLLEDMLPSLSEELYPTSEENVQSIYKKIQSGDTAAGETEVVLCRGT 1015
gi 447068248  948 GGGPIRHVDKPYSELREGDVGYDEDLLDISDDSPLLEDMLPSLSEELYPTSEENVQSIYKKLQSGATAAGETEVVLCRGT 1027
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 920009332 1027 IGPQAENIVSFKTAGGIEGGDVEVLPVSAEIAQEQVRSGRIVPEYTTDLSVADRFSREHYLIIVKVKVRYLTRGSVSESG 1106
gi 502672854 1016 IASQAENIVSYSTAGGAEIANPNVNPVSEDIAKLQIKSGRIEPEYTTDISVADRFSRGHHLVIVKVRVKYLTRGSISESG 1095
gi 485743856 1022 TGIQAENIVEYKTAGGLPDSNPNVKAPDEYMAQQQVRIGRILPEYTSDLSVADRFSREHYLIVVKVKAKYITRGSVTESG 1101
gi 447045763 1016 TGPQAENIVKLKTAGGVEGADPNVLPVSEETARLQVRNGRVVPEYTTDLSVADRFSREHYLIIVKVKAKYITRGSVSESG 1095
gi 447068248 1028 TGPQAENIVKLKTAGGVEGADPNVLPVSEETARLQVRNGRVVPEYTTDLSVADRFSREHYLIIVKVKAKYITRGSVSESG 1107
                        1130      1140      1150
                  ....*....|....*....|....*....|.
gi 920009332 1107 WVMPKNTPVDPVGIIDRTYGKAENTGQANAS 1137
gi 502672854 1096 WIIPQNAPIEPVGLIDRTYGQPENIQQANAS 1126
gi 485743856 1102 WVIDKTAPVEPLAIIDRTFGMKENISMVNAS 1132
gi 447045763 1096 WVMPYTAPVEPVGIIDRTYGHAENIGQANAS 1126
gi 447068248 1108 WVIPHTAPVEPVGIIDRTYGHAENIGQANAS 1138
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap