Conserved Protein Domain Family
CCCAP

?
pfam15964: CCCAP 
Centrosomal colon cancer autoantigen protein family
CCCAP is a family of proteins found in eukaryotes. CCCAP is also known as SDCCAG8, serologically defined colon cancer antigen 8. It is associated with the centrosome.
Statistics
?
PSSM-Id: 318229
View PSSM: pfam15964
Aligned: 5 rows
Threshold Bit Score: 774.078
Threshold Setting Gi: 332320542
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81883282    6 GNSTLEDSLGQYQRSLRERANRSIHQLKCAL--REVDATIEEDALDPSTSINVEN--------VDTGV-AWHELQHSHAV 74
gi 74713839    6 ENSTLEEILGQYQRSLREHASRSIHQLTCAL--KEGDVTIGEDAPNLSFSTSVGN--------EDART-AWPELQQSHAV 74
gi 332320542   5 lESDEEEELGALQKTLRERANRSIQHLSSMLagHSSDSETSEPNQQELLSSVQQN--------------PCSPVQQSEAV 70
gi 363731875   6 GQPALEESLQRYQRRLRERANESIHQLKYAL--EDRHFAESKDEVEFDQSSVDKGsddvdrdsDDSGSpPWEELQHSHAV 83
gi 611989903  71 GDTALEEALGHYQRSLRERANRSIHQLKCAL--QESDIIVGEDEFEQEESYRESVt-------EESGS-TWQELHHSHAV 140
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81883282   75 NQLKALLRQQTSTEN--ETSP-RRRKLSPSRPSDCEDGSLPTMHNLVPIINDQSQYIHHLEAEVKFCKDELSSMKNRVQV 151
gi 74713839   75 NQLKDLLRQQADKES--EVSPsRRRKMSPLRSLEHEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQV 152
gi 332320542  71 SQLRSLLQMKTKDANiqSLSP-SRRKLAAKRATDDGSSSQPGVHNLVPIINNQSEYIQHLEAEVKFCKEELLEMKQRVRV 149
gi 363731875  84 NQLKILLQHQEKMES--EASP-SRRKMQFQKTPEAATEDLPDPSDLIPRINDQSQYIDHLEAEVKFCKEELSEMKDQVRA 160
gi 611989903 141 TQLKALLNQQNSKEN--EISQpRRRKILPSKTSEDENSSFPAVFDLVPIINDQSQYIHHLEAEVKFCKEELSGMKQRIQM 218
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81883282  152 VVLENERLQQELKSQRQEETLREQTLLDMSGNVQNSWMkTREDSRVIETTKRPFSHGDAETGKAASTGDadkwRLELERL 231
gi 74713839  153 VVLENEGLQQQLKSQRQEETLREQTLLDASGNMHNSWItTGEDSGVGETSKRPFSHDNADFGKAASAGE----QLELEKL 228
gi 332320542 150 VIVENEKLHHELKAKTIEDTLKEYTFVDSTLNMEHT-----------------AENTLKERLGSVNQAEdhkwRKEMEQL 212
gi 363731875 161 VILENEDLHQKLNFLTAEYTLGEQALLHTSANNQNSRC---NDLKLHQPSISSAAQNGDPALVSKTVGEvekwHVELEKL 237
gi 611989903 219 VVLENEKLQEDLKSRQSEQRV-EQIIMDSSGNPQNSWV-TPVDFRKCQDSKLIVTPNALDQVKS-TTSDlekwQLELERL 295
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81883282  232 KLTYEAKTDLLESQLKLLRKDLVEYQKTCEDLKERLKHKESL-VTASASSRVGGLCLKCAQHEAVLSQTHNNVHIQTIET 310
gi 74713839  229 KLTYEEKCEIEESQLKFLRNDLAEYQRTCEDLKEQLKHKEFL-LAANTCNRVGGLCLKCAQHEAVLSQTHTNVHMQTIER 307
gi 332320542 213 KCLYQAQTETLEAQVVSLKKDLACIQKEYEESKERLRHKEAMaVAAGTGQRVSGLCLKCAQHEAVLAETHTNVHVQSIER 292
gi 363731875 238 KLLYQDKINVLEGQVQSLRKHLSESQKTCEDLEARLKHQKSL-VSATNSSRVGGLCLKCAQQEAVLAQTHSNVHMQVIER 316
gi 611989903 296 KLIYEEKNEVLESQVNSLRKDLCESQKNCEELKGRLRHLESL---NSTSNRIGGLCLKCSQHEAVLTQTHTSTHIQTIER 372
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81883282  311 LTKERDDLMSVLVSVRSSLAEAQERETSAYKQVKHAVQMTEEANFEKTKALIQCEQLRSELERQTDRLEKELASQQEKRA 390
gi 74713839  308 LVKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKALIQCDQLRKELERQAERLEKELASQQEKRA 387
gi 332320542 293 LTKERDELMTVLCSLRASQTDAQQREWGAYQQVKQAVEMAEEANLEKTRALVQCEHFHNELTRQRERLERELASEQDKIS 372
gi 363731875 317 VTKERDDLMDALVSVRQTMKEMQQRESNAYEQVKQAVQMTEEANLEKTKALVQCEQLKSEMERQKNRLEKELAVQLNKRT 396
gi 611989903 373 LTKERDDLMSALVGLRKTLSEMQQMESSAYEQVKQAVLMTEEANFEKTKSLIQCEQLKTELERQKSRFEKELEVQQEKRF 452
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81883282  391 LEKEMIKKEVTREREEAEAKMLILSQNIAKLEAEIEKITREKTSAVSQLEEVQNQLASQEMDVTKVCGEMRFQLNKTKME 470
gi 74713839  388 IEKDMMKKEITKEREYMGSKMLILSQNIAQLEAQVEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKTNME 467
gi 332320542 373 QAREAARSESKKEREELMQTLSSLSQKVAELQGLLDRGERDRNSLNSQLEEAYKKLTVQETDSSKMCAELRFLLSQAQLK 452
gi 363731875 397 EEKEALREEMKKERENLAAMVMAMSENVAMLEAQVERVTREKNSLVNQLEESQHQLASHEMEMNKVCGEMRYQLNQTKMK 476
gi 611989903 453 SEKETLRQEMKKEREDLGATMIALSQNMAQLETQMEKVTREKLSIASQLEAAQKQLASHDVDLTEVCGEMRYQLNQTKMK 532
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81883282  471 KDEAEKEHKEYKAKSQKDLEMKDQEIEKLRLELSESTQQVEQEQQKAARARQECLQVTELLGESERQLHLTRLEKDSIQQ 550
gi 74713839  468 KDEAEKEHREFRAKTNRDLEIKDQEIEKLRIELDESKQHLEQEQQKAALAREECLRLTELLGESEHQLHLTRQEKDSIQQ 547
gi 332320542 453 KEEAERDVRDISSKLGRQLELAEQEVQKLGVELSGYRQRLEEAQRAEGRARAEAAGLAEGLSRAQRQLHLTRQEKEASER 532
gi 363731875 477 KDEAEKELREYRTKTIRQLEIKDQKIEKLGLELNGNKQRLEQAQQDVAGAREDCLKLTELLSKSEHQLHLTRLEKESIQR 556
gi 611989903 533 KDEAEKEHREYRTKTLRELEFKDQEIEKLKLELNESKQRMEQAQQDGARARDECIKLTELLGQTEHQLHLTRLEKGSIQQ 612
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81883282  551 SFSNEAKAQALQALQREQELTQKIQQMETQHDKTDSEQYLLLTSQNTFLTKLKEECCILAKKLEKVSLKSRSEIVQLSQE 630
gi 74713839  548 SFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLKEECCTLAKKLEQISQKTRSEIAQLSQE 627
gi 332320542 533 CCGEDMAALTFQAQRRERELTQTLQQMEAQHEKSVRETDALLSAQNSLIRKLKEECHTLGAKLEELAQSSRAEMEQLSLE 612
gi 363731875 557 SISNEAKARALQAQQREQELTQKMQQMEAQHEKTVNELDSLLTSQKTFIAKLKKECCLLASKLEEMTEKYRSKVNQLSQE 636
gi 611989903 613 SFSNNAKAQALQAQQREQELTQKMQQMEAQHDKAENERYSLLSSQNAFMAKLKEECCMLAEKLEEITDKSRCEVSKLNQE 692
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 81883282  631 KRYLCDKLEKLQKRNDELEDQCVQHGRVHETMKERLRQLDKHGQATAQQLVQLLNKQNQLLLERQNLSEEVDQLRAQLP 709
gi 74713839  628 KRYTYDKLGKLQRRNEELEEQCVQHGRVHETMKQRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDRLRTQLP 706
gi 332320542 613 REHLQESAEKLRGRCEEMEEQCVQHGRMHQRMKQRLQQLDQHCQASSQQVLQLLSRQKQLMQERQQLTEDLHSLKSQVH 691
gi 363731875 637 KEYLHGRLEKMQKRNDELDQQCIQHGRMHERMKSRLHQLDKHCQTTAQQLVELLNKQNQLFKEKQLLTEEVQFLRTQek 715
gi 611989903 693 NKYMTDRLEKLQNRNKELEDQCVQHGKMHERMKLRLNQLDRHCETTAQQLVLLLKKQNELFKERQNLAEEVQSLKSQVL 771
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap