Conserved Protein Domain Family
Mannosyl_trans4

?
pfam15971: Mannosyl_trans4 
DolP-mannose mannosyltransferase
This family catalyzes the transfer of mannose from DolP-mannose to the N-linked tetrasaccharide bound to the S-layer glycoprotein to form a pentasaccharide.
Statistics
?
PSSM-Id: 318233
View PSSM: pfam15971
Aligned: 3 rows
Threshold Bit Score: 182.345
Threshold Setting Gi: 502709480
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74517758   18 GGRLYVDAWEPKLPLSYETTGVLALLSGGDMYRLHLLSVVLMSGAVCAIVALVVMLVYDITGDDIVAPLAGLSMFLLPGF 97
gi 510785792  57 GKRYYIDAWDPKPPLTLELATIIAYISNGDPHLQHTLSVVSTIVAGILLTYLISHITSEITGNQFAGLLSGIVFITFPVI 136
gi 502709480  57 GGVPYVDVWDVNPPVPFGIAAVLAALSGGNMLVLHGLGATLTTLVAAASVLLVGWIARHVTGDDAAAIAAGLAMLVVPEL 136
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74517758   98 AVRPAYGFKAKYLLVLCGLLAIYLYTRGYPALSGVAAAASVGYWQAGAIFPLIVVGLAVQRRDMRALERVVAGGLGFTIV 177
gi 510785792 137 HYSAVFGYEPKYFVFLFGLGSIYLSRNPKPILSGAAAAASAGMWQFAIIFPIISFGIISRRKSKDLILKYVFGATIIAFI 216
gi 502709480 137 FLLSPEGVRAQFYALFFGVLALALALRDRPFLAGAAAALSAGSWQSGAVFALLVVGMAYQRNGGKDVLSvvgggavvtga 216

                 ...
gi 74517758  178 MLL 180
gi 510785792 217 SLL 219
gi 502709480 217 vvl 219
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap