Conserved Protein Domain Family
HTH_46

?
pfam15977: HTH_46 
Winged helix-turn-helix DNA binding
Statistics
?
PSSM-Id: 318239
View PSSM: pfam15977
Aligned: 19 rows
Threshold Bit Score: 93.4255
Threshold Setting Gi: 640473100
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 123755792    8 SYEQIRATLLSMIDWNEELRSRIGVMNYIHQRTRISRSVVAEVLAALRKGGYIEMNK-GKLVAINRLPS 75
gi 81520565   154 AYSQIKALLLELWSYPESSRFEINAQNFIQQRTGLSRSRIMQVLSELKAGDYIKILH-GRLLELRNLPV 221
gi 81524029   165 SYLKVRALLTEIWAYPQAYRESIIVLNFIQRRTGISRSRTMKILSELKKGGYIHIDN-GRLTALGKLPV 232
gi 494977201  139 TYSQIRSTLLTMAAWSPEVRAQVGVIHHIQNHTHISRSVIAEILAELRKGKYIEMQK-GKLVAVNKLPL 206
gi 490994193  161 SFIMIRTLILELGSYPEEYREQINVLNFIQRRTNLSRSGILYVLSELRKGDYISVHR-GVLKGINKrip 228
gi 1020142377 150 SYTLIRNCLIELAAKNEQEREEINACDFIRGKTNLSQSYILKVFSDLRKGDYIDISR-GRLKSINKLPD 217
gi 938460821  139 SYMLVRKSLITLGEMPLESRININASQYITSTTNLSKSYVMKVIQELRKGGYIEIQR-GRLITIGKLPQ 206
gi 571167083   76 TYSVIRNHLLEMMLLSEETRQRVSILEYIQDRTLLSRSSILNVLSALKKGGYITFARgGYLQNIVSLPE 144
gi 938460670  134 SYSMIKANIDCLATMDEFMRNRINVADYIVKKTNLSRSMVMKTLSQLRGAKNIEISK-GKLVAVHHLPE 201
gi 488373334  139 TYNIICNHLRDMILLPEEMRSKITILKYIQDRTHLSRSSILNIISSLNKNHYISYRRgGYLISVNDLPD 207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap