Conserved Protein Domain Family
UPF0767

?
pfam15990: UPF0767 
UPF0767 family
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between and 92 amino acids in length. There are two conserved sequence motifs: IGYN and SPSL.
Statistics
?
PSSM-Id: 318247
View PSSM: pfam15990
Aligned: 18 rows
Threshold Bit Score: 112.482
Threshold Setting Gi: 353232626
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123892754  1 MWPVLWAAARTYAPYITFPVAFVVGAVGYQLEWFIRGTPEQPveELSILEKREERTLQETMGK-DVTQVLSLKEKlEFTP 79
gi 121954372  1 MWPIILHFLRTNAVYITLPVAALVGVVGYNLENLLSDKYTPY--SESIEEKRVERITDDEHLK-DATKVDKLVYK----- 72
gi 121996609  1 MWPLILQFMRANAAYITLPVAALVGVIGYNLENILSDKYTPY--NKSIEDQRVDRLT-DEVLK-DPTNVKKLKYQ----- 71
gi 321468437  1 MWPVLINMLRVNAPYITLPFAAIIGVIGYNIERIISDRTTPF--KNSVEEQRDERMLKNLENV-DAKEMESLKEK-KFVP 76
gi 149689216  1 MFPVIFRVLKAYAPYITLPAAAMVGIIGYNIENWVSDKYTPY--QESISKKRSERLLENELNGiD----ESLKEK-KFVA 73
gi 195027243  1 MWPVVMALLRRNAVYITLPIAAVVGFIGYNLEDLLSDKYTPY--SPSIQEIRVKRLADESSVE-NAAKVEKLRLN----- 72
gi 242014969  2 YWALLSRLISNYSLVLVFPISATVGFIGYKIEQLISDRYTPA--LKSVKDEREERLLQED------KDVESLKKH-AFVP 72
gi 357629467  1 MWPIIMQFLRSNATYITLPVAAVVGIIGYNLEGLLSDRYTPY--NKPVQDQRFERLE-DEMLK-DPTNVQKLKYK----- 71
gi 568251386  1 MWPLIMQFLRSNAAYITLPVAAVVGVIGYNIESLLSDKYTPY--SASIQEKRAERITQEERLK-DATHVEKLVYK----- 72
gi 161076551  1 MWPIVMALIRRNAVYITLPIAGVVGFIGYNIESWISDKYTPY--SPSIQELRAKRLTEESLNT-DAANVEKLRLS----- 72

                ....*..
gi 123892754 80 KAVLNRN 86
gi 121954372 73 ENVLGRN 79
gi 121996609 72 ENVLGKN 78
gi 321468437 77 RTIFEKN 83
gi 149689216 74 KSVFDKN 80
gi 195027243 73 SSVLERN 79
gi 242014969 73 KTIFEKN 79
gi 357629467 72 ENVLGKN 78
gi 568251386 73 ENVLGRN 79
gi 161076551 73 SPVLERN 79
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap