Conserved Protein Domain Family
DUF4769

?
pfam15992: DUF4769 
Domain of unknown function (DUF4769)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 291 and 501 amino acids in length.
Statistics
?
PSSM-Id: 318249
View PSSM: pfam15992
Aligned: 6 rows
Threshold Bit Score: 421.578
Threshold Setting Gi: 968046446
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122087181  48 SWDVADLLPHLQDEAINVDELQMIKRHHLSELLRNFRFGTRIRFEHHLERWRRWLNVPLQGAQGQGSS------------ 115
gi 122121163  18 SWDVADLLPHLQDEAINVDELQMIKRHHLAELLSNFRFGTRIRFEHHLERWRRWLNVPLQGVQGQSQT------------ 85
gi 24652107   48 SWDVADLLPHLQDEAINVDELQMIKRHHLSELLRNFRFGTRIRFEHHLERWRRWLNVPLQGAQGQGSS------------ 115
gi 195430404  33 SWNVGELLPHFQDEAINVEELQMLKRHHLNELMGHFRYGTRIRFEHHLERWRHWMNVPLMGSPSEAAG------------ 100
gi 195147266  16 SWDLTDLIPRLEEETINVEELQMMKRHHLDELMSNFRMGTRIRFEHHLELWRRSLNVPLQGVHWSRP------------- 82
gi 968046446  30 SWNVSELLPYLQEEAINTQELQMLKRHHMNELLRNFRYGTRIRFEHHLERWRRWLNVPLQDEQNCGAGsstsaagsgsgs 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122087181 116 ---HCSGCRC-----------------PEILGQSQcqEQSPLHMEQPSEQEELHKPEDLVKT-----------IPAESLV 164
gi 122121163  86 ---HCQGCRC-----------------AESAAPSI--ICHPQMGGQSDSAADSGKSDDLAKT-----------LPAEPLV 132
gi 24652107  116 ---HCSGCRC-----------------PEILGQSQcqEQSPLHMEQPSEQEELHKPEDLVKT-----------IPAESLV 164
gi 195430404 101 ---HCSGCRCstatvssaaaavaaasnAGTIGVCQ--PQITSVRSVENPMVVATKPEESLNS-----------RNVEPLV 164
gi 195147266  83 ---HCHGCRC-----------------ATIQLQTD---CASDCGKSDISLTERHSPRETVPDamqpilepvqiLSTSPVT 139
gi 968046446 110 gsvHCSGCNC-----------------STNLAKSH---------------SKSNLGDERAKQ-----------LPSEPFV 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122087181 165 ALSDPREMSVPfplplvhppaqitddimmvkqelmPMQQTRKPEAVLA-----AGSS--GGTSGNKEDATATPDQEVSIL 237
gi 122121163 133 SLTDPRETVQApf--------------------hiPMQPQLEPSEILSt----TLVT--NVKEEDSGDQVTGEDRVVTVL 186
gi 24652107  165 ALSDPREMSVPfplplvhppaqitddimmvkqelmPMQQTRKPEAVLA-----AGSS--GGTSGNKEDATATPDQEVSIL 237
gi 195430404 165 SLNETCDSNSFn------------------------MTPLTDHTELVHttlggGSGT--LKQEREGSEPDASEEGAVTVL 218
gi 195147266 140 NLNVEVQYRTVp----------------------dAMQPILEPVQILSt----SPVT--NSNVEDGGEYVPGEDLGVTVL 191
gi 968046446 147 SLNEMTDGGTFn-----------------------VPLPLGDHSELVHt----ELVTadLIKPEIMTDADGSEESGVTVL 199
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122087181 238 GILRSSGMKAQSLLERIGQNDPLDAVQRLLLIQLVCSYYEENQMHLTLQRSHLLEREILQLFPQEQLSYYRTERRGKIYV 317
gi 122121163 187 GILQAGGMKSQSLLDRLGQQEALDAVQRLLLIQLICSYYEDNQLHLTLQRSHLLEREILQLFPKEQLQYYRTERRGKIYV 266
gi 24652107  238 GILRSSGMKAQSLLERIGQNDPLDAVQRLLLIQLVCSYYEENQMHLTLQRSHLLEREILQLFPQEQLSYYRTERRGKIYV 317
gi 195430404 219 GILQVSGIKAQSLLERLGQNEQLDAVQRLLLIQLICSYYEDNQLHLTLQRSHLLEREILELFPKEQLHFYRTERRGKIYV 298
gi 195147266 192 GILQAEYIKSQTLLELVGQQEELSAEQRQLLIQLICSYFEDHQLHLSLHHSYKLENEILQLFPKELLEHYRTKKRGKIYA 271
gi 968046446 200 SILQASPVKAQSLLERIGQNEQLDAVQRLLLIQLICSYYEDNRLHLTLQRSHLLEREILQLYPKEQLCFYRTERRGKIYV 279
                        330
                 ....*....|
gi 122087181 318 RFTNMKRSKR 327
gi 122121163 267 RFTNMKRNKR 276
gi 24652107  318 RFTNMKRSKR 327
gi 195430404 299 RFTNMKRNKR 308
gi 195147266 272 R-CSYAKNKR 280
gi 968046446 280 RFTNMKRNKR 289
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap