Conserved Protein Domain Family
Headcase

?
pfam16002: Headcase 
Headcase protein
This domain is found in Drosophila Headcase protein and the human Headcase protein homolog. In humans, it may have a role in some cancers.
Statistics
?
PSSM-Id: 318259
View PSSM: pfam16002
Aligned: 14 rows
Threshold Bit Score: 273.439
Threshold Setting Gi: 339251868
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390331625   434 FLPRMDLSAFyQVLPAHKLNSYHIKMEEDSQPE-SEEIRSFIFATLNIHGTRVIPCSVCTRKLPVFDRYPLIDGTFYLTP 512
gi 985397708   308 FCRRLDFSTF-NRLPRHMLNSYHVKIEDEGNHG-NDETRSFILSSLAAQNQSRVNCVLCSDVMLVFDRYPLVDGTFFLSP 385
gi 1036853361  432 FSRRLDFSSF-NLLPKTRLNSYQVKIEDEGNHG-NDETRLFILSSLAQSQMSRVACILCEEPLLVFDRYPLVDGSFFLSP 509
gi 357605640   206 FSRRLDFSTF-NLLPKYKVNSYQIKIEDEGNHG-NDDTRLFILSTLAGQHKPRVSCALCKETLHVFDRYPLVDGTFFLSP 283
gi 241295504   235 FCRRQDYSSF-NTLPWHKINSYNIKMEDEG--G-SDDMRCFILSTLTANKMSRIPCILCHTQMNVFDRYPLVDGTLFLSP 310
gi 321462209   243 FVHRANFSSF-NALPRHKLNSYHIKMEDEGSYG-NDDIRCFILSNLATAKMSKTFCVVCQNAMQIYDRYPLIDGTFFLAP 320
gi 1005970642  322 FCRRQDYSSF-NNLPKHKINSYHIKMEDD--HG-NDETRNFILSTLSANRMNRVSCIMCHTSMMIFDKYPLIDGTFFLSP 397
gi 47219870    565 FLRRLDLSELlTHLPRHKVNTYHVRMEDDAQAGqGEELRRFILSALSASQRNVVNCALCHRALPVFEQFPLVDGTLFLSP 644
gi 340371061   260 FAHRTDYSVFdRFLPRHLINGYHIKMEDDGYAA-GDETRSFVLSSLAFHRTNTVTCVLCNDSLCVYDRYPLLNGTLFLSP 338
gi 339251868   184 FRRRQNLESFrKALPRSKINGINIKLEDDCPQG-NDETRLFVLTNLGDHKRRTVTCIICQSLLPVYDRYPLIDGTFFLSP 262
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390331625   513 QRQGDGnkGLQVGLQ-Ss-QYLNAVCMQCLEGVQ---R--IVCRICKSR-WD-GSHHQLGTLYSYDIFAAYPCCPGRAGC 583
gi 985397708   386 KQYNKN--AVEVKNEgRa-LFLNAVCMKCLDGKDadrK--LCCRFCATQ-WD-GSSLIMGTMYAYDVFAAMPCCNERLKC 458
gi 1036853361  510 KQHSSG--CIEVKYEgRt-LYLTCVCMSCLDGTSs--SrvINCRFCKEP-WD-GSSLVLGTMYAYDIFAAMPCCAERFKC 582
gi 357605640   284 RQHTSS--AVEVKVEgRt-QFLTCVCMGCLERCDperT--ICCRFCGQK-WD-GSSLVLGTMYSYDIFMATPCCAERLKC 356
gi 241295504   311 RQHSAG--AVQVRIDeRp-QFLNAVCMTCLEGWQg--R--LACRGCGSR-WN-GRHLILGTMYAYDIFAATPCCEFRLRC 381
gi 321462209   321 KQYSKA--CIPVTSEgRq-QYLSAVCMSCLEGWTc--T--LRCRSCRTP-WN-GGSFILGTLYSYDVFAGTPCCPERLRC 391
gi 1005970642  398 TQHSKG--AVLTTVEgKn-QYLNAVCMSCLEGWNs--T--LKCRSCSTC-WT-GSHLILGSMYSYDIFAAVPCCTDRLRC 468
gi 47219870    645 SRHDEMeyDVPCHLQgRl-MHLYAICVDCLEGVH---K--IVCIKCKSR-WD-GSWHQLGTMYTYDILAASPCCQARLNC 716
gi 340371061   339 IQLYSS--SLEVEGKgDdpVFMSAVCLACMVGLNs-----IKCLSCSKQ-WD-GSSHQIGTLYTYDLFSSTLCCPSCVLC 409
gi 339251868   263 INHENL--GVMVNYEgSs-LYLLSLCMYCMESAP---K--LMCILCGSEgWFiGNKLIYGTLYTYDVLAAVHCCFPR--C 332
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|
gi 390331625   584 KRCGKPVIDPTRGTHFFSEYSRSIQCPHCGVPDFHFVKPL 623
gi 985397708   459 NGCQKALMLSHQRLNFYSDYSRKVTCPHCTSVDYHFVKPL 498
gi 1036853361  583 NNCFKMLMHPQQRLSFYSDYSHGVTCPYCNTQDTHFVKPL 622
gi 357605640   357 NNCYKPLLHPHQRLN-YSDYSHPLTCPHCRVVDTHFVKPL 395
gi 241295504   382 TNCHELVIGADRSLQYFSDYSHSVCCAHCGARDYHFVKPL 421
gi 321462209   392 NQCNGLVVQPEQRFQNFSQYSRDLSCPHCASHDHHFVKPL 431
gi 1005970642  469 NNCKNLVISPDHGLQFFSHYSNAIACGHCGTVDFHFAKPL 508
gi 47219870    717 KHCGKPVVDVRVGMQYFSEYSNVQQCPHCGNLDYHFVKPF 756
gi 340371061   410 KKCSKPMLDFGKVTLSFTSLSSLYECPYCSHRDYHFLKSS 449
gi 339251868   333 YSCYGTIPTAEEKNSFF-RFSEMSACPHCSVNGYHFIRRV 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap