3V69


Conserved Protein Domain Family
MOEP19

?
pfam16005: MOEP19 
Click on image for an interactive view with Cn3D
KH-like RNA-binding domain
MOEP19 is a family of mammalian KH-like RNA-binding motifs. The family is expressed during early embryogenesis. It appears to effect an early form of molecular asymmetry within the murine oocyte cytoplasm. The family marks a defined cortical cytoplasmic domain in oocytes and provides evidence for mammalian oocyte polarity and a form of pre-patterning that persists in zygotes and early embryos through the morula stage.
Statistics
?
PSSM-Id: 318262
View PSSM: pfam16005
Aligned: 28 rows
Threshold Bit Score: 82.2699
Threshold Setting Gi: 511902555
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3V69_A        45 LPKWFHVECLEDPKRLYVEPRLLEIMFGKDGEHIPHLESMLHTLIHVNVWGP-ERRAEIWIFGPPPFRRDVDRMLTDLAH 123
gi 731460673  89 tcqpwiCEPLRLP---HLEVWLVEVIFCLSGEHILHVECMSQTILLVSWLDP-THEAKILMSGQPYYQKDVAKIIMNLAD 164
gi 731454261  29 RPFWFNAEHLMNPYRVYLEAWLVEAIFGPGGEHIPHVECVSQTILRVRRVDP-EGKAEILIFGRPYYQKDIAKIITNLAD 107
gi 511902555  33 QQYWCKFKHFLKPSVLNVEARLLEKIFGPSRVLLPGFEREFKVVLQMRKPNS-EGKVEIFILGRRRYRKRAKRLIRILTT 111
gi 237681314  12 LSWVGAPEDFTEPEVFQVQTRLLEALFGPEGSRIPYVEKVSKVMLEMKALES-SDLTEVMVYGPYLYKFRTKWMLQSMAE 90
gi 27718517   11 PPWVKVPEDLKDPEVFQVHTLVLKSLFGPQGSRMPHIEQVSRAMFELKILES-SGLTEVLIYGSCNHKLRAKWMLQSMAE 89
gi 655842642  21 QPWWKVPENFDAPVVVYLEEEQEEQIFGHNDAHLRCIEVHSQTLIQLESWFTaRGQTRVTIVGPPRARQWLMDMIWSLGN 100
gi 284005355  11 PPWVKVPEDLKDPEVLQVQTRLLEAMFGPDGSRIPYIEQVSKAMLELKALES-SDLTEVVVYGSYMYKLRTKWMLQSMAE 89
gi 426353727  11 EPWWTLPENFHSPMVFHMEEDQEELIFGLDDTYLRCIELHSHTLIQLEKCFTaTGQTRVTVVGPPMAKQWLLLMFHCVGS 90
gi 205716438  12 PPWVKVPEDLTDPEVFQVQSLVLKYLFGPQGSRMSHIEQVSQAMFELKNLESpEELIEVFIYGYQSIKVRAKWLLQSMAE 91

                 .
3V69_A       124 Y 124
gi 731460673 165 C 165
gi 731454261 108 Y 108
gi 511902555 112 k 112
gi 237681314  91 W 91
gi 27718517   90 R 90
gi 655842642 101 r 101
gi 284005355  90 W 90
gi 426353727  91 Q 91
gi 205716438  92 R 92
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap