Conserved Protein Domain Family
DUF4777

?
pfam16007: DUF4777 
Domain of unknown function (DUF4777)
This presumed domain is functionally uncharacterized. This domain family is found in eukaryotes, and is approximately 70 amino acids in length.
Statistics
?
PSSM-Id: 318264
View PSSM: pfam16007
Aligned: 20 rows
Threshold Bit Score: 70.3649
Threshold Setting Gi: 242020069
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 74869435     1 MPNFNGAIIVHTLQLL--KAPATLREIVVTIAKNTELSQDELKEPVKQTLEMGHRLGFLQKLDGRYFL 66
gi 74949053    14 LIPNLFSNILQVIADA--DHPLTEPEIMDAVADRLDRSDEELKRQITVSLHDALIYGYLRVKNYRYSI 79
gi 242020069  152 ckINTSKLILLAINDVckNDGISIREVVGKICQNGKLKENDVKKDVKRFFDKAVQKGLLTKTNGLYKI 219
gi 969462215  908 hghhhgqhggggvggvaggrgskrdsfnslngtdliagafceldptqplnkMAVIEGRMRRS----SP 971
gi 195340857  155 PLPDLFSAVMSLVTEL--KRSVSYPEIIGCLSKRLHREQVELKRHVPHTLHAAVNNGYLKKEGNRYSL 220
gi 195133550   14 LIPNLFSSILRVVAES--DRPLTQHEIVEAVSERLDRSDEELKRQVTVNLHDALIYGYLRVKNYRYSI 79
gi 195047192    2 SRYAYSDLILEAFIEF--QRSMTMDEIVEYVAEMSDSSACEVRLQVDNTLTAAWLHGFVERDNDLYSL 67
gi 194764350    2 SRYMYADHILEAFNVF--HRPMAIDEVATYVAEMEAKSVEEVRLAVDNTVTAAWMHGFLAKDDRNYTL 67
gi 968067594    2 SRYLYGDKILEAFRVF--RRPLTLVEVVDYVAEMEAKSIVEVRLEVDNTLTAAWLHGLVKREDDLFTL 67
gi 195397421    2 SRYRYGDLILEAFMEF--RRPMALEEVVEYVAEMADRSIVEVRLPVDNTLTAAWLHGFVQRDNDLYSL 67
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap