Conserved Protein Domain Family
DUF4778

?
pfam16008: DUF4778 
Domain of unknown function (DUF4778)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 321 and 791 amino acids in length. There is a single completely conserved residue P that may be functionally important.
Statistics
?
PSSM-Id: 318265
View PSSM: pfam16008
Aligned: 9 rows
Threshold Bit Score: 237.801
Threshold Setting Gi: 195033367
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121994893  48 ECRWHYWSHRNDLAVRQLAKLLEGCPEKVAGFLFDLTLQNYNRLLHPRRCG--YSACHVPYCHPYVCERYMGIFDDQGNL 125
gi 74864787   35 SQEHCLWRQRNQMEIEQLAKLVGFQPDEIDGFLFNLSLRNYSDLLKYKECG--WNGCNVPLCYPYVCDRYMAIFDHRGNL 112
gi 194762375  46 sgaRRFWRERNDLVIQRMAKLLDCYPEEIGGFLHELTLQNYSRLLYPVGCG--RSPCNVPLCHPTVCDRYMGIFDEGGNL 123
gi 195385777  93 SSPRDYWFNANRGIILALSRAVGLHADVVSDFLYTLTMQNFAKVLNPRNSY--CYNCHVPLCTFDACDFNCGIFDSEGNV 170
gi 195063815  21 LSSWDLWYARNMKQIKRLASELNKPTREITELIYNLTLQKFNRLLNPRGMR--WNNCRVPFACPAVCDRYVDIFDLDGNV 98
gi 195580713  70 KSHKERWFLTNQRIILALATTLNRPPDLVSDFLHTLTLQNFSEILHPVETEtlGPSCKVPFVNCGACENFMRIFDTHGNV 149
gi 964091536  72 TDPKSRWFDVHKHIILSMAITLNRPPDVVLDFLYNLSMQNFRNILEPFRGYp-AGPCNVPFANGNICTQYMSIFDTRGNV 150
gi 195033367  68 SSLKLRWHRTNRNIIMALARVLDIQADIVSDFLYTLSLQNFGQVLRPQGRQqlSSRCRVPLSDLDICDTYCSIFDGSGNL 147
gi 195156225  70 LTDKQRWFLINQSIIFALGKILGRPADVVSEFLYSLTLQNFSKVLNPVGHP--WSTCHVPLSNYDTCDYYMGIFDSQGNL 147
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121994893 126 RDPTHPRSLFQLLKLLQNFLKGQ------------------------------------TPGCVPLPFDSSLREEERAPV 169
gi 74864787  113 RSPIHARSLKSLLPLLLDYLNGDspndrkdspiyeaypdehqakcrsnieqsdleamssSDWISQLLGNPSESKREKTGK 192
gi 194762375 124 RDPTNPRSLFSLLYLLQRCLNGQplggcsglpinsnkkcgfeecyprtgpenyigldqeKVWQLYRFGNPKKRKRLRDQS 203
gi 195385777 171 RTPYQPESLLKLLSVLQLVLKGGke--------------------------------seNGAHKCLFGDAKCPARKFGLR 218
gi 195063815  99 RDPANPWNLSKLLKLMQAILKLT------------------------------------DVNRINEPTNNAIRADLCRSK 142
gi 195580713 150 RSRLSQDSLQLLMEAVQTVLQ------------------------------------------------QSPPTELRALD 181
gi 964091536 151 RNPFHRNSLAMLIRMMQNVLS-----------------------------------------------NKQFRRHSPIDD 183
gi 195033367 148 RNPYHPESLLQLLTILQSVLKAGkelk-----------------------------esaNAAHGKLFGQESTQSKge--- 195
gi 195156225 148 RNPYHPESLKKLIQVMQSVLRERpd--------------------------------adNGAHDALFGDVIMRRRRGKNR 195
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121994893 170 mrhrsmdpigtrclrWGVTELSGPSRpm-------qSKQKGKKSPGQLKR------------------------------ 212
gi 74864787  193 ktek--------pqpVMRSELESELEse-------sEMEKKKRKNKTFGR------------------------------ 227
gi 194762375 204 msfvpspsiistrvtVPRSSISSTYVsnmrvlksedsmeDSWRSRPGIKT------------------------------ 253
gi 195385777 219 ptrc-------tqkiADRSGIGPNSLar----------qNGLRRRFTRYE------------------------------ 251
gi 195063815 143 krdgghmkierslkvASEQMPNSSAArr----------lKASKKEEDSKEehvldaeiptngsplnassrvatplnatsh 212
gi 195580713 182 agfsgqrgaikrhsiARRAGIDRDSI----------ARQNGRRRLRNSEA------------------------------ 221
gi 964091536 184 ffvqphplrdraaerAKRAGIDSSSA----------ARQNGRRRLREADF------------------------------ 223
gi 195033367 196 -------------rlAHRAGIGEDSL----------ARQNGRRRRYRLYA------------------------------ 222
gi 195156225 196 ---------------AKRAGIGPESA----------AQDRGQRRIQESNE------------------------------ 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121994893 213 -------------KEDDEKSEE-----------------------------------SKgyaeirgsleisphyrvpgkd 244
gi 74864787  228 -------------QSVFLNDELalayaksydyaeylmk----tlgrhrfrdsyigpvGD--------------------- 269
gi 194762375 254 -------------Thtdpqmdper-------------------------------------------------------- 264
gi 195385777 252 -------------Ryyldgndpnagkpgagdaaleastrrkhfd------------------------------------ 282
gi 195063815 213 gaypmrvfgerahRllasdll----------------------------------------------------------- 233
gi 195580713 222 -------------RASENRSHLntgleqrtagdpgyvf---gsslesaglnamhtpeKWaftd----------------- 268
gi 964091536 224 -------------KAQENRRILynemtdflyhkpdvgsrfweavepktlqdfdlndnEYgiss----------------- 273
gi 195033367 223 -------------Nylhdgfdtlfdv--------------------kknfaapfapnSEdlgysrnpfiankrsnalaqd 269
gi 195156225 221 -------------RAQELARNLnrigthcdwhehrerkp--peygipcfgtpfgppnAFgpgagiltpdrgdpfglkgsp 285
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121994893 245 gdavsfysqdl----------------sddsryqlmiddkgrrrgmgshsaqlgnlrsEQ---------------ALYLK 293
gi 74864787  270 ----------------------------------------------------------LR---------------TTRTH 276
gi 194762375 265 ------------------------------------------------nfeaeliniqRR---------------ASQIR 281
gi 195385777 283 ----------------------------nmegyigyckgsiakatsglyagekliaysER---------------RDYLR 319
gi 195063815 234 ----------------------------------------------------ltdrkgRRhghgspqldnlrseqHRILN 261
gi 195580713 269 ------------------------------------------------------slalER---------------TRRLS 279
gi 964091536 274 ------------------------------------------------------afstYQ---------------AEELT 284
gi 195033367 270 lgaadanlwlsk-------------ypkelshvdkfnnrfygnyaayskslgdvgqgrRS---------------GIHLR 321
gi 195156225 286 wgrgglnggafgagrrlsesfsisfdetlfkgpdgqvlqadqdgsgrgfsrdrrpgssPR---------------GKELS 350
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121994893 294 RLIAKMNERRRLERDPQKVLRAMSQLDLedggpaqdqKTRRNEA------------------------------------ 337
gi 74864787  277 ILIRDLIARKGMNINEKNLRKALKKVDLewkgttradYKREMKT------------------------------------ 320
gi 194762375 282 EIFNDFVEQQIVHVDAVNLMEAIRLVDLgdlesesdeKRKGIGKvsa-------------------------------nk 330
gi 195385777 320 KLLNRIKDRVGIERNLDDLVVALTGFDL---------NKARESEmsrt------------------------------rg 360
gi 195063815 262 EIFRNLSR-----MDPERFLEALTGADLteedaklmkGEKVNVS------------------------------------ 300
gi 195580713 280 KLLIQVNEKTYLTRDTEKLITAIKELNLdsnvtnpkkQPPRHSIm----------------------------------- 324
gi 964091536 285 ALIDLLNQRVLLTRHLDDLLEAIKSLKLvdpavektgLSRVSAEri---------------------------------- 330
gi 195033367 322 HLIRNVNAKVGIGHDPSDLANAMGKLDL---------NEVQVNEanakampdayrgmspgvrshmlppgkkwkmnshlyh 392
gi 195156225 351 SLIDGVNKKTKLTKDLGTLIDAVTGLDV---------EPKQQKDitks------------------------------kh 391
                        490
                 ....*....|
gi 121994893 338 -VAELSKFYT 346
gi 74864787  321 -AQEISRLYN 329
gi 194762375 331 iVDEISKFYN 340
gi 195385777 361 iAQNISKEYN 370
gi 195063815 301 -VKDVSAFYT 309
gi 195580713 325 -ANVISDSYY 333
gi 964091536 331 yVKEISKSYN 340
gi 195033367 393 gARTISHQYH 402
gi 195156225 392 lQRRLSDEYN 401
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap