Conserved Protein Domain Family
DUF4788

?
pfam16032: DUF4788 
Domain of unknown function (DUF4788)
This presumed domain is functionally uncharacterized. This domain family is found in eukaryotes, and is approximately 230 amino acids in length. There is a single completely conserved residue D that may be functionally important.
Statistics
?
PSSM-Id: 318288
View PSSM: pfam16032
Aligned: 23 rows
Threshold Bit Score: 212.948
Threshold Setting Gi: 195452618
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121991178  10 VVSHLELPHdDISEP-KHLQVSMHFGKVPLTLTSSCINVREFPAGSQTDFIDNPKSLRQTLAANGLPITVRLAGRTLGTG 88
gi 195054734  17 IVTRLQFIKdKIDDP-ADLLINLKFNSIGVSITSSRINVGDFRAGRCTEFVSDPSALRTNLERNGMPITVRNKGMTLGTA 95
gi 195109847  16 IVTRLQLTKdKVDDP-SKLIVNLKFNNIPMSITPSRINVDNFKAGRQSAITCDPEILRQGLETQGMPMTVRYSGMTVGTA 94
gi 968059600  13 IVTYLKTTEiKIEDP-KKLQVDVCFDNKPLQITSSRINVKDFKGESSFEFSSNAEILRQNVAAYGMPVIVKYNGKVIGLG 91
gi 195109845  11 IVTRLELSKhEIDEP-QNLLVNVDFNKNQLKVTSSRINVDQFDVMKGINCQTDPAVLRDYLEANGLTVIVRYNGVVLGKG 89
gi 195108613  14 ILEKSTLKHkPGEPC--PYTYMVCPYKQYLKVTDDRIYGKEFPAEALGEFVANPYELAESLTSKGIRLAIYENGQLLGCG 91
gi 195108611  13 IVLQSSLPVvEGEE--SPYNYRVRLYNEFLELSPDRVVTEYFPNNPISTFVASPCDLVGSLSSKGICVTVYENGNLFGCG 90
gi 195037401  13 IVTKSSLQPnDAQEStNPFKYCIRLFNSSIDVPPNRLFVKHFPSSSLGEFVASPCELVGSLSERGISVTIYENDEMLGCG 92
gi 194745981  15 VVTHLELKGiNAE-P-QNLNASIKFPQRAWKMGASRINVTDFPPNREEQIVSSPCRMRDALEANGIVLGVLYSGSTVGAA 92
gi 195570977  17 VVTSLDLEK-PVKET-ELLEAQVKFGGVNIKITNSRINVQDFINNRLTQFTTSPSALRQSLEDQGMQISARYAGSSLGTN 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121991178  89 KVQFPDDFTDRIDNPMSDLMYGGSCSLLRNNEIIGVLEIMLRLTIKC--EDPPIEPN-TGSKRr---------------- 149
gi 195054734  96 LVALPQSFIDRIEVGMSDLVFEHKCSIIRRDAEVGTLEFLCTLIIKC--DEQPQQTV-T-CNS----------------- 154
gi 195109847  95 TLKFPQSFIDRIQDGMSDLFHQDSCTLVKRDAVAGTLEVFCSLIIKC--ETLIETTE--PCKK----------------- 153
gi 968059600  92 NIGFPPVFIDRIDANMNDILCASSCRFQLAGKVAGTLEVLCRLYMKC--TDTSRPRE-PDCSQ----------------- 151
gi 195109845  90 CVPFLESFINQIDYDMDYLTYASTCNLFGNHSLVGSIDVMCLLTIKC--ESQDDFVG--PCKD----------------- 148
gi 195108613  92 SFRPIDDILRPLTEPTFTATGAYVVDAEQEGVRVARVDF--NIKFSAadPQLDSRMIpFGCFD----------------- 152
gi 195108611  91 TCRPSTGLLRMLADPTFSCTESLNITLEKGKRRMGHLHL--KINISSvdPDLDARLLpFGCYD----------------- 151
gi 195037401  93 NCKLSPSLLRRLADQTFSVNEVVPVLLENNKKRVAELDL--NIKFSStqPDLDTRLLpFGCYD----------------- 153
gi 194745981  93 TMSFPQEFLDKICPTMSDLLHTDNLQLMRRKDVVGSVTIVVRLTLKCe-KDRDSITTkIADSRakvqfiqpgvtelevpq 171
gi 195570977  95 VLLFPDTFIDKISSKMNDLFFEATINLMRRADCIGTITIRLVLIIKCidTDIIKEPRrSSSPRmsrksiaedi------- 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121991178 150 --------pSCVNLGPTINQQDIMFMVGSAEPC-EIPSDPCDDHLEaEPGDEQLQWDLSRYRSRNSR------IDYDEPE 214
gi 195054734 155 ---------ACENLAKAFNPTDIMFVVGAPQPC-PLPCEPCLDELEpEEGDERLQLDLDRYRRRSQR------VTTPPEK 218
gi 195109847 154 ---------SCANLGKAIKEADILFVIGRNDPC-DSVCEPCAEQIDtVEGDERLRMDLSRYRGDNQR------ASLPPAE 217
gi 968059600 152 ---------TAKN---SIHPQDIMFLMGDVLHC-PKASDICPDILPpD--DNKLRFELESYQSAGPKtdplrpLEPLLNK 216
gi 195109845 149 ---------ACGN----IAKKDIMILMRNPDTD-AIADKSYLTEAEeQENDIQLGLDLSRYRSINQR------MSQSSED 208
gi 195108613 153 ---------ICRTLDTSINPRDIIFTLGRSKRT---ASVACIT-------DKRLMSFGEAPFSCVRK-----------EV 202
gi 195108611 152 ---------VCRPQDKSVNPRDIIFTLGRSRKC---AGTTCIT-------DERLMSQAGAPFNCTHN----------ENP 202
gi 195037401 154 ---------VCRPLDKSVNPRDVIFTLGRSHRC---AATTCIT-------DERLMSHAGAPFTCMHK----------KIE 204
gi 194745981 172 dvpktkrrvSFSSLGHTINPQDVMFTIGDPDPVlEIPSNPCSELAE-ADGDRLLSLDLARYSSMKNSrv---vLPDDLPC 247
gi 195570977 168 lpkkemkkeSCQGLGPTINPQDVMFVIGDPDPLlKIPSEPCSELLF-EDGDVRLDLDLQRYRSLENRrl---vLPDDDPC 243
                        250       260
                 ....*....|....*....|....
gi 121991178 215 PQEKPCLGHLRQLTDKYAGIIQSV 238
gi 195054734 219 ICGMEACCQLKTMTKQYEECIESV 242
gi 195109847 218 NYKLEATSVLKAMTDQCGLAIDSV 241
gi 968059600 217 PVTSGATCGIKTLGRRPERFTDIV 240
gi 195109845 209 SSGTEACYLLRAMATEYAQIIDSV 232
gi 195108613 203 NSTAGCGCVLHGTDTVVPKALDRs 226
gi 195108611 203 PAGKECSCGVRGAKT--PPAMDPT 224
gi 195037401 205 PTGKECSCMVKGVKP--PPELDAA 226
gi 194745981 248 LKEKPSLRQLKEITRQFTHIVDSV 271
gi 195570977 244 LKEKPSISQLRQLTHHYSRIIGMV 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap