Conserved Protein Domain Family
DUF4791

?
pfam16039: DUF4791 
Domain of unknown function (DUF4791)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 189 and 203 amino acids in length. There are two conserved sequence motifs: PLPL and LGN. There is a single completely conserved residue N that may be functionally important.
Statistics
?
PSSM-Id: 318295
View PSSM: pfam16039
Aligned: 28 rows
Threshold Bit Score: 208.256
Threshold Setting Gi: 195164892
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74869811    31 PEEHPFAMVACVVVGFSAVFGLLRVIFAsgqPEEC----QQLRDITSGVLELAPLPLANMDFYMQSTGlSPIALGHAFFV 106
10_pfamImport   1 PSEHPYAFSACVIGFCHGLFGLVDSFSG---NETS----KSAKETSNSILEIVPLPLVNIELFFGGDA-NNIALGHGLFI 72
15_pfamImport   1 PQEHPFAFSACLIGFCHGLLGLIDIFVG---NDNT----HKAKKTTNAIMEVVPLPLVNMELFFSGES-NNIALGHGLFI 72
8_pfamImport    1 PSEHPYAFTACVFGFCHGLFGLVSGLTG---DDNA----KKVTETTTSIMEIIPLPLVNVELYLAAES-NNIALGHGLFI 72
2_pfamImport    1 PAEHPYAFTACVIGFCHGLFGLVDFAAG---GDTT----KSMKETTTSMMEIIPLPLVNVDLYLGAES-NNIALGHGLFI 72
25_pfamImport   1 --EFPLALTSFSLLISHGILGTIKFTS----IEQNnv-iRKLYDQSTLLLVILPISSLNAELFRLAGYsNGFVIGHLFSS 73
gi 121993926   28 PQEHPYAFTACVVGFCHGLLGLVATVSG---DENT----TKANDATNALMEIVPLPLVNVDLFMGADS-NNLALGHGLFI 99
gi 195041179   28 PSEHPYAFSACVIGFCHGLFGLVDSFSG---NETS----KSAKETSNSILEIVPLPLVNIELFFGGDA-NNIALGHGLFI 99
gi 195448659   30 PGEHPYAFTGCVVGLCHGLLGLVNCFSD---DSNV----NNAKEKSTSFMEIVPLPLINVDLYFGSAS-NNLALGHGLFI 101
gi 195088198   31 lERQTFAFVACLVGGAAALVGLCRALFG---SSTTitgrSRARDVCQGMLELVPLPLINMQLYEHRLGlGNVVLAHGILL 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74869811   107 L-PLFCDL-GCSLAK-DrR-----DCAfS----D-------SLRNLTVLGNIVSLGFLAYVER-NFLYLRMVLVMIVVKY 166
10_pfamImport  73 V-PMAICI-LVGLIQ-GkG-----DGEgD----Evi----eTLKLLTILGNITSLSYLAVNEG-SWLMGAMAFLSFMTKY 135
15_pfamImport  73 V-PMAISV-LAGLIK-G-E-----GEEvD----Eai----dTLKLLTMLGNITSLCYLAINEG-SMIMGGMAVLAFLTKI 134
8_pfamImport   73 V-PLAVSV-ILTFFK-G--------ESgD----EseggaldTLKTLTILGNITSLAYLAINES-SWNLGGMAFLAFMAKF 136
2_pfamImport   73 V-PLAVSV-ILGMVK-G-G-----DDGgE----Esp---mgTLKTLTILGNITSLLYLAINES-SWNLAGMAFLAFMAKF 135
25_pfamImport  74 LiPLLTQF-FLGDFN-R------------------------LVIDGILAGNLISMMYYSVMHDpGTWSGGLAMMTGLNRF 127
gi 121993926  100 V-PLAVSV-IIGWAK-D-N-----DENgsv---------idALKTLTVLGNITSMVYLALNES-SWNLGGMAFLAFMAKF 160
gi 195041179  100 V-PMAICI-LVGLIQ-G-KgdgegDEV-I----E-------TLKLLTILGNITSLSYLAVNEG-SWLMGAMAFLSFMTKY 162
gi 195448659  102 V-PMAVSA-LLGLFK-D-E-----SEG-QgeavE-------TLKTLTILGNITALLYLAINDG-SWNLGGMAFLAFLAKF 163
gi 195088198  108 L-PPLLLDlRCSLVKeR-K-----NCDlT----E-------TLRDLSMLGNIVSLLFLAAREH-NFLYMRMGLVMLLVKY 168
                         170       180       190
                  ....*....|....*....|....*....|..
gi 74869811   167 GVVLVDSIK-EDAGEDLQVCGTALFMHLLGKA 197
10_pfamImport 136 GSEYLETQI-EGSGDPVKYVSWSVFYFLTTMV 166
15_pfamImport 135 GSEYLETQI-EGSGDPVKYLSWSGFYLLATFA 165
8_pfamImport  137 GAKFFEEQIsEGSGEPVNYLSWSGFYFLTAMA 168
2_pfamImport  136 GAQFCDENVsEGSGEPITYISWSGFFVLAAMA 167
25_pfamImport 128 ---VFEKVA-SRYDVPLSDINSVGQIFFTMFA 155
gi 121993926  161 GAAFFEENVsEGTGQPITYISWSGFFFLTALA 192
gi 195041179  163 GSEYLETQI-EGSGDPVKYVSWSVFYFLTTMV 193
gi 195448659  164 GAQYGEEQS-QGAGEPITYLSWTGFYILAAMA 194
gi 195088198  169 YPVLADSAQ-EETGEDLIVCGSALLFHQLGHA 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap