Conserved Protein Domain Family
FAM76

?
pfam16046: FAM76 
FAM76 protein
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 233 and 341 amino acids in length.
Statistics
?
PSSM-Id: 318302
View PSSM: pfam16046
Aligned: 17 rows
Threshold Bit Score: 271.561
Threshold Setting Gi: 313230919
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1005939785   8 LFACTRCNSRHPFEELSSGQQLCKEC--------RGA--LVK------------CTYCRTEFQQESKSnLNTICKKCEQN 65
gi 156399895    3 LFACTKCHSRHPFEELSRGDQLCKKC--------RKSfpLVT------------CTFCRLEFHLLDKT-ERPVCKKCDSN 61
gi 353233169    5 LFSCTKCLRNFPQSEMSRSGQACKGC--------SPHhsTFKq-----------CEYCKSDFKYRV---CGGICPRCQSL 62
gi 674594705    5 MFSCARCRKSYPSSQMSRSGTYCKKC--------NPHhsSFKq-----------CDYCRSDFKRSI---SGSLCPRCQSL 62
gi 198420144   25 qYACTKCMQWFDFDDLSADVQMCKVCtdtlastsSKTsvTVKkekvskstrpenCRYCQTYIKVKVPG-EKRICERCFKN 103
gi 556992809    5 LYACTKCNQRYPFEELSQGQQLCKEC--------RIAhpMVK------------CTYCRSEFQQESK--TNTICKKCAQN 62
gi 410915396    6 LYACTKCNQRYPFEELSQGQQLCKEC--------RIAhpIVK------------CTYCRSEFQQESK--TNTICKKCAQN 63
gi 149604728    4 LYACTKCHQRFPFEALSQGQQLCKEC--------RIAhpMVK------------CTYCRTEFQQESK--TNTICKKCAQN 61
gi 321471759    4 LFACSRCFSRHPFEELSQGQQLCKEC--------RGSfpIVK------------CTYCRSEFQQESKGnTSTICKKCEFN 63
gi 642924370    5 LFACSRCFSRHPFEELSAGQQLCKEC--------RGAfpVVK------------CTYCRSEFQQTSKGsTSTICKKCEQN 64
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1005939785  66 VKLYGKPSACEYCNIIAAF-IGNKCQRCTNSEKKYGQPLACEQCKQRCAFDRKDpESRKKVDGKLLCWLCTLSYKRALAK 144
gi 156399895   62 IKQYGQPTCCVYCNIRAAF-NGDKCSRCESSEKKYGTPVLCEQCKLKCAFKKSD-ESKEKVDGKVLCLLCTLSYKRLVHK 139
gi 353233169   63 KSKYGEPQPCSICNLKTAFgSALVCQRCLHYRNRFGEPRQCHSCGDTCAFLKDE-ASREKVDGQILCWVCTYNFKLARSR 141
gi 674594705   63 KSRYGDPKPCSICQLTMAFgIALVCQRCLHYRSKFGDPRQCEKCLQLCAFYKDE-ASRKKVDGQVLCWVCTYNYKVSKAK 141
gi 198420144  104 RKEYGEPKICMFCTLNSAF-IGSKCQRCASSKKKYGMPVNCQKCNLKAAFDHKK-A---HIDGLLLCWKCYVSMQRYQKR 178
gi 556992809   63 VKQFGTPKPCQYCNIIAAF-IGTKCQRCTNSEKKYGPPQTCEQCKQQCAFDRKE-EGRRKVDGKLLCWLCTLSYKRVLQK 140
gi 410915396   64 VKQFGTPKPCQYCNIIAAF-IGTKCQRCTNSEKKYGPPQTCEQCKQQCAFDRKE-EGRRKVDGKLLCWLCTLSYRRVLQK 141
gi 149604728   62 VKLYGTPKPCQYCNVIAAF-IGHKCQRCTNSEKKYGLPHGCEQCKQQCAFDRKD--DRKKVDGKLLCWLCTLSYKRVLQK 138
gi 321471759   64 VKQYGKPSACEYCNIIAAF-IGNKCQRCTNSEKKYGPPVTCEQCKQKCAFDRKD-EDKKKVDGKMLCWLCTLSYRRALAK 141
gi 642924370   65 VKAYGKPTACEYCNIIAAF-IGNKCQRCTNSEIKYGPPVNCEQCKQKCAFDRHD-DD-KKVDGKLLCWLCTLSFKRALAK 141
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1005939785 145 AKQNDT-Sirh------------------------------------------------tsISVHKSGSRSSSSSRQKge 175
gi 156399895  140 SKGKVH-Grs-------------------------------------------------ssQHKGVKRSHHHPKHEKKsk 169
gi 353233169  142 ERSIHGsNkr-------------------------------------------------rhDNYQLSTANRSRSSHNSlk 172
gi 674594705  142 ARSDKHqSkr-------------------------------------------------snLGDLKSHGSLSPSKRQRte 172
gi 198420144  179 EKRKGE-EnpgendeenetkksrlskpetsgketappsddenertwrellgedhclksgkkSENLKLKSHNEKKHELRkq 257
gi 556992809  141 TKEQRK-Slgs------------------------------------------------shSNSSTSLTEKDQHHSkhhh 171
gi 410915396  142 TKEQRK-Gfg---------------------------------------------------ssNSSSLNEKDHHSRshhh 169
gi 149604728  139 TKEQRK-Hls---------------------------------------------------ssARAGQPEKEQFSRLSss 166
gi 321471759  142 TKHSErg----------------------------------------------------shSNSSKTKEQQQQQHRSSsg 169
gi 642924370  142 TKQGDA-Err-------------------------------------------------ahMKISQLHKSKHKEGKLRg- 170
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1005939785 176 -------srSHHH-----HRSH-------------HNSSSNL----MvppgssssskkprleigvktsngslkipsmtTT 226
gi 156399895  170 vaklqeskqSSQS-----SR---------------DSPVTAL------------------------------------GL 193
gi 353233169  173 ktctdgygtRQTD-----TQVH-------------L-------------------------------------------- 190
gi 674594705  173 eissrhslnHAANvltdgNRPS-------------SITGSKAwirfGk-----------------------------lLN 210
gi 198420144  258 aqinsrnlnKHHS-----SSSLddriqkmekrgtpPVSVSSP----R--------------------------------R 296
gi 556992809  172 hh--hhhhhHHHS-----SSHN-------------HKSSSSI----Qnetp------------------------kkkPK 203
gi 410915396  170 hq--hrhssSHHK-----LSGSlspeqeqglwkqsHK-SSSI----Qketp------------------------kkkPK 213
gi 149604728  167 ssssssgggSHYN-----SQKTl--------------sTSSI----Qneip------------------------kkkPK 199
gi 321471759  170 hhnhhnshhGHHD-----KRPQ-------------RPDVTKV----Glgered--------------------tgppaKI 207
gi 642924370  171 -----------HN-----KRPH-------------RVDVTKL----Paldnd---------------------ngiptKV 196
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1005939785 227 TTVAE-----S-----T-------------------------------------MMDLtnsdhvvAVTQLREQMASLQKQ 259
gi 156399895  194 YSASSgnsdtG-----G-------------------------------------EAimsg--qmaELNDLKEQVAKLKRQ 229
gi 353233169  191 ---QQavttqA-----L-------------------------------------SLDSvynehllTISQLQDEIKSLKRQ 225
gi 674594705  211 DAARCirrtrK-----Kql---------------------------------slSLGSayndqmvTISQLQEEMRNLKRT 252
gi 198420144  297 NEEKPgsntsT-----PrqgvtaeirsnsgtpntptpsshkpydrlrngamdlsTALPqmndnivLVTKLHEEINSLKKN 371
gi 556992809  204 LESKP-----Sng-dsSsi---------------------------------nqSMDTsgtdnfiLISQLKEEVMSLKRL 244
gi 410915396  214 LELKP-----Sng-dsSsi---------------------------------tqSMDSggtdnfiLISQLKEEVMSLKRL 254
gi 149604728  200 FDAIV-----AngdsfSpd----------------------------------lALDSpgtdhfvIIAQLKEEVATLKKM 240
gi 321471759  208 FRPMI-----Nrd----------------------------------------aMVDPnssdhvvAITELREQVATLQKQ 242
gi 642924370  197 SRNNA-----SpglirA-------------------------------------ELDPnssdhvvAMTQLKEKIATLQKQ 234
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1005939785 260 LSKKDQELLEKDKKIAELRSQLSREEREWREKLTQCQKGSSEKTTQLQQKISQLLKQNASLSKA 323
gi 156399895  230 LQQKDQALLEKEKKLTELKAENWEKEKVSKKKVMSLQKEMTDRIDTLQTENRNLRKQLSSLSRT 293
gi 353233169  226 LTLKDFDLLTKDRTIAELRSEMIEVKSMNEDRVRKIKSTAQLEQDRLLATIRQLQKEKAMIIHN 289
gi 674594705  253 LAQKDSELLAKDRVIAGLRADLGDFEAQRRERAYKSQALANEEIEKLKDTIRTLRREKADILAS 316
gi 198420144  372 IAKKDQVMLEKDKQISMLKVEHLRLERSLQTKLKTQEEEFFRKMEAMGIKNQELIKKVAQLSKK 435
gi 556992809  245 LQQRDQTILEKDKKLTELKADFQYQESNLRTKMNGMEKAHKETVEQLQAKNRELLKQVAALSKG 308
gi 410915396  255 LQQRDQTILEKDRKLTELKADFQYQESNMRVKMNQMEKSHKDSMELQQAKNRELMKQVAALSKG 318
gi 149604728  241 LHQKDQMILEKEKKITELKADLQYQESQMRAKVNQMEKTHKDVTEQLQAKNRELLKQAAALSKG 304
gi 321471759  243 LAVKDNQLLAKEKQITELKAGQFRMDQEHRVRIKTIQKEHEAKVDILQERIKTFQKEVATLNKA 306
gi 642924370  235 LSLKDTQLLNKDKMITELKAKHFTTESELRTKMKNCQKECDDKIEALNKRITSLLKEVASLSKS 298
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap